Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8W3U8

Protein Details
Accession A0A1S8W3U8    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-40AENQSSPKPNLKKPKPPKAVDDETIHydrophilic
335-358TTTASSTPLKRKRESKKSASSLSAHydrophilic
NLS Segment(s)
PositionSequence
27-31KKPKP
344-351KRKRESKK
393-400KKKKSAKK
Subcellular Location(s) mito 14, cyto_mito 11.999, cyto_nucl 8.166, cyto 7.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036898  RNA_pol_Rpb7-like_N_sf  
IPR041178  RPA43_OB  
IPR045113  Rpb7-like  
IPR005576  Rpb7-like_N  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF17875  RPA43_OB  
PF03876  SHS2_Rpb7-N  
Amino Acid Sequences MSKVASKVRAAKVSAAENQSSPKPNLKKPKPPKAVDDETITTTLISPLDPLLAKDGGAVSTKATPKGERLTSPFLKIYAEIRVCLAPSFIKTPLDGVRNYLNTFIMRYISELGGVVLAYSNVELTSSEGHIMDESPFSFFNIRALFTLFSPKVGSTLYGVVNKVSPDHIGLLVYGMFNASIPSSHIRHDEFYWDTDGHAWRFSSAKDKSTLFIATNSIVKFTVDSLISANKLLAISGSLTTHPDDTGVVDSTGMAAPTLLKPPIFEEENNMEVDVVQSTHVTFSDEEDEPAENVNEDDSDVDDYSHTTLRQTDTGAEEEEEAAAAVSVSVQRGNTTTASSTPLKRKRESKKSASSLSALAPTSRKKSKSDLVVDNASPIAAKVSSEGNEVSSKKKKSAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.43
4 0.38
5 0.4
6 0.41
7 0.42
8 0.39
9 0.42
10 0.45
11 0.52
12 0.62
13 0.68
14 0.73
15 0.79
16 0.87
17 0.87
18 0.85
19 0.85
20 0.83
21 0.81
22 0.74
23 0.7
24 0.61
25 0.54
26 0.49
27 0.41
28 0.31
29 0.23
30 0.21
31 0.14
32 0.11
33 0.09
34 0.08
35 0.11
36 0.11
37 0.11
38 0.13
39 0.13
40 0.13
41 0.13
42 0.14
43 0.12
44 0.14
45 0.13
46 0.11
47 0.17
48 0.2
49 0.22
50 0.24
51 0.24
52 0.27
53 0.35
54 0.37
55 0.35
56 0.39
57 0.45
58 0.46
59 0.48
60 0.44
61 0.37
62 0.34
63 0.31
64 0.27
65 0.26
66 0.24
67 0.21
68 0.21
69 0.21
70 0.21
71 0.2
72 0.19
73 0.12
74 0.13
75 0.16
76 0.16
77 0.16
78 0.15
79 0.19
80 0.22
81 0.25
82 0.23
83 0.23
84 0.27
85 0.28
86 0.29
87 0.27
88 0.23
89 0.2
90 0.21
91 0.18
92 0.14
93 0.12
94 0.13
95 0.14
96 0.12
97 0.12
98 0.11
99 0.1
100 0.08
101 0.08
102 0.06
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.03
109 0.04
110 0.04
111 0.05
112 0.06
113 0.07
114 0.08
115 0.08
116 0.08
117 0.08
118 0.09
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.1
126 0.09
127 0.12
128 0.12
129 0.13
130 0.12
131 0.14
132 0.13
133 0.13
134 0.2
135 0.16
136 0.16
137 0.16
138 0.15
139 0.15
140 0.14
141 0.14
142 0.08
143 0.11
144 0.13
145 0.14
146 0.14
147 0.14
148 0.15
149 0.14
150 0.13
151 0.11
152 0.09
153 0.08
154 0.09
155 0.09
156 0.08
157 0.07
158 0.07
159 0.07
160 0.06
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.05
169 0.08
170 0.09
171 0.11
172 0.13
173 0.14
174 0.16
175 0.16
176 0.19
177 0.17
178 0.17
179 0.18
180 0.16
181 0.15
182 0.16
183 0.17
184 0.14
185 0.13
186 0.12
187 0.11
188 0.11
189 0.12
190 0.17
191 0.17
192 0.19
193 0.21
194 0.21
195 0.21
196 0.22
197 0.23
198 0.15
199 0.15
200 0.14
201 0.12
202 0.14
203 0.14
204 0.12
205 0.11
206 0.11
207 0.1
208 0.09
209 0.1
210 0.07
211 0.08
212 0.08
213 0.09
214 0.1
215 0.1
216 0.09
217 0.07
218 0.07
219 0.06
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.06
226 0.07
227 0.08
228 0.09
229 0.08
230 0.08
231 0.07
232 0.07
233 0.09
234 0.09
235 0.08
236 0.07
237 0.07
238 0.08
239 0.08
240 0.07
241 0.05
242 0.04
243 0.05
244 0.06
245 0.09
246 0.08
247 0.08
248 0.09
249 0.11
250 0.15
251 0.16
252 0.15
253 0.19
254 0.22
255 0.23
256 0.23
257 0.21
258 0.17
259 0.15
260 0.15
261 0.1
262 0.06
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.08
269 0.07
270 0.09
271 0.14
272 0.14
273 0.14
274 0.15
275 0.15
276 0.14
277 0.15
278 0.13
279 0.08
280 0.08
281 0.08
282 0.07
283 0.06
284 0.06
285 0.06
286 0.08
287 0.08
288 0.08
289 0.08
290 0.09
291 0.1
292 0.12
293 0.11
294 0.1
295 0.13
296 0.15
297 0.16
298 0.17
299 0.17
300 0.18
301 0.2
302 0.2
303 0.18
304 0.16
305 0.15
306 0.14
307 0.11
308 0.08
309 0.06
310 0.05
311 0.04
312 0.03
313 0.04
314 0.05
315 0.05
316 0.07
317 0.07
318 0.08
319 0.09
320 0.12
321 0.12
322 0.14
323 0.14
324 0.14
325 0.2
326 0.23
327 0.29
328 0.36
329 0.44
330 0.49
331 0.55
332 0.64
333 0.7
334 0.77
335 0.8
336 0.81
337 0.83
338 0.84
339 0.83
340 0.77
341 0.68
342 0.59
343 0.52
344 0.46
345 0.35
346 0.3
347 0.29
348 0.3
349 0.36
350 0.41
351 0.42
352 0.42
353 0.49
354 0.55
355 0.6
356 0.63
357 0.64
358 0.63
359 0.65
360 0.61
361 0.55
362 0.47
363 0.36
364 0.27
365 0.19
366 0.15
367 0.09
368 0.09
369 0.09
370 0.13
371 0.14
372 0.17
373 0.17
374 0.17
375 0.23
376 0.25
377 0.32
378 0.36
379 0.39
380 0.45