Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XQD8

Protein Details
Accession B7XQD8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
149-170TNCSDKCKAVNCCKRNKTGKCQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
Amino Acid Sequences LCLCPNSISKKILIRFEEMCLTSELKFESCPFRKWWKHSARFYWHIYPTTNQTHIDKINNYLATVQQNINNVKKVNDINLDAFIFDETKLQESVSSEESEDCCCCDCNFQPSPLLQGTPIPMGSTIPLAGNFGGNGYSCVNIDCSPQTTNCSDKCKAVNCCKRNKTGKCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.43
4 0.44
5 0.37
6 0.33
7 0.28
8 0.27
9 0.22
10 0.22
11 0.2
12 0.15
13 0.15
14 0.16
15 0.24
16 0.26
17 0.29
18 0.33
19 0.42
20 0.5
21 0.55
22 0.63
23 0.64
24 0.7
25 0.75
26 0.79
27 0.77
28 0.75
29 0.75
30 0.72
31 0.64
32 0.57
33 0.5
34 0.43
35 0.41
36 0.4
37 0.36
38 0.31
39 0.28
40 0.3
41 0.31
42 0.32
43 0.27
44 0.26
45 0.29
46 0.27
47 0.25
48 0.22
49 0.21
50 0.19
51 0.2
52 0.18
53 0.14
54 0.19
55 0.22
56 0.24
57 0.24
58 0.23
59 0.21
60 0.24
61 0.23
62 0.21
63 0.2
64 0.19
65 0.17
66 0.18
67 0.18
68 0.14
69 0.13
70 0.1
71 0.08
72 0.06
73 0.07
74 0.05
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.1
81 0.11
82 0.11
83 0.1
84 0.11
85 0.12
86 0.13
87 0.12
88 0.1
89 0.09
90 0.09
91 0.09
92 0.12
93 0.13
94 0.18
95 0.2
96 0.21
97 0.23
98 0.22
99 0.26
100 0.22
101 0.21
102 0.15
103 0.14
104 0.15
105 0.14
106 0.13
107 0.1
108 0.09
109 0.09
110 0.09
111 0.09
112 0.08
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.08
123 0.08
124 0.08
125 0.08
126 0.09
127 0.11
128 0.11
129 0.13
130 0.14
131 0.16
132 0.17
133 0.18
134 0.22
135 0.23
136 0.29
137 0.31
138 0.36
139 0.36
140 0.39
141 0.44
142 0.49
143 0.55
144 0.6
145 0.66
146 0.67
147 0.76
148 0.78
149 0.82
150 0.84