Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XQD8

Protein Details
Accession B7XQD8   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
149-170TNCSDKCKAVNCCKRNKTGKCQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Amino Acid Sequences LCLCPNSISKKILIRFEEMCLTSELKFESCPFRKWWKHSARFYWHIYPTTNQTHIDKINNYLATVQQNINNVKKVNDINLDAFIFDETKLQESVSSEESEDCCCCDCNFQPSPLLQGTPIPMGSTIPLAGNFGGNGYSCVNIDCSPQTTNCSDKCKAVNCCKRNKTGKCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.43
4 0.44
5 0.37
6 0.33
7 0.28
8 0.27
9 0.22
10 0.22
11 0.2
12 0.15
13 0.15
14 0.16
15 0.24
16 0.26
17 0.29
18 0.33
19 0.42
20 0.5
21 0.55
22 0.63
23 0.64
24 0.7
25 0.75
26 0.79
27 0.77
28 0.75
29 0.75
30 0.72
31 0.64
32 0.57
33 0.5
34 0.43
35 0.41
36 0.4
37 0.36
38 0.31
39 0.28
40 0.3
41 0.31
42 0.32
43 0.27
44 0.26
45 0.29
46 0.27
47 0.25
48 0.22
49 0.21
50 0.19
51 0.2
52 0.18
53 0.14
54 0.19
55 0.22
56 0.24
57 0.24
58 0.23
59 0.21
60 0.24
61 0.23
62 0.21
63 0.2
64 0.19
65 0.17
66 0.18
67 0.18
68 0.14
69 0.13
70 0.1
71 0.08
72 0.06
73 0.07
74 0.05
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.1
81 0.11
82 0.11
83 0.1
84 0.11
85 0.12
86 0.13
87 0.12
88 0.1
89 0.09
90 0.09
91 0.09
92 0.12
93 0.13
94 0.18
95 0.2
96 0.21
97 0.23
98 0.22
99 0.26
100 0.22
101 0.21
102 0.15
103 0.14
104 0.15
105 0.14
106 0.13
107 0.1
108 0.09
109 0.09
110 0.09
111 0.09
112 0.08
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.08
123 0.08
124 0.08
125 0.08
126 0.09
127 0.11
128 0.11
129 0.13
130 0.14
131 0.16
132 0.17
133 0.18
134 0.22
135 0.23
136 0.29
137 0.31
138 0.36
139 0.36
140 0.39
141 0.44
142 0.49
143 0.55
144 0.6
145 0.66
146 0.67
147 0.76
148 0.78
149 0.82
150 0.84