Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XN32

Protein Details
Accession B7XN32    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-33TYVSKNKGAKRGKAKGKENRFSKNKFHydrophilic
NLS Segment(s)
PositionSequence
12-28KNKGAKRGKAKGKENRF
Subcellular Location(s) mito 20.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001593  Ribosomal_S3Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01015  Ribosomal_S3Ae  
Amino Acid Sequences MAIRAAGTYVSKNKGAKRGKAKGKENRFSKNKFYNLTSRLFPITNHGTTSHPKMRSKQDLTPFLVGRTFSVNQGDLECADPMNAVNSPRYFKFKVNAVCGNNCNSVFNGMEVSREKITGMIRKWHTLIEANIPITTKDGSTWRVFVNAVTKKKNPDSLKHYAKHQNQISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.56
4 0.61
5 0.68
6 0.73
7 0.79
8 0.84
9 0.84
10 0.87
11 0.87
12 0.84
13 0.84
14 0.82
15 0.78
16 0.77
17 0.76
18 0.72
19 0.67
20 0.64
21 0.63
22 0.58
23 0.57
24 0.48
25 0.42
26 0.38
27 0.34
28 0.29
29 0.27
30 0.29
31 0.26
32 0.26
33 0.24
34 0.25
35 0.27
36 0.35
37 0.35
38 0.35
39 0.38
40 0.42
41 0.5
42 0.57
43 0.59
44 0.58
45 0.59
46 0.6
47 0.6
48 0.59
49 0.5
50 0.41
51 0.37
52 0.3
53 0.22
54 0.2
55 0.17
56 0.13
57 0.14
58 0.14
59 0.13
60 0.14
61 0.13
62 0.09
63 0.1
64 0.09
65 0.07
66 0.06
67 0.06
68 0.05
69 0.06
70 0.06
71 0.06
72 0.08
73 0.09
74 0.11
75 0.12
76 0.18
77 0.19
78 0.2
79 0.22
80 0.27
81 0.31
82 0.35
83 0.4
84 0.37
85 0.38
86 0.38
87 0.38
88 0.34
89 0.29
90 0.24
91 0.18
92 0.18
93 0.15
94 0.13
95 0.12
96 0.09
97 0.12
98 0.12
99 0.15
100 0.14
101 0.13
102 0.13
103 0.14
104 0.17
105 0.21
106 0.22
107 0.28
108 0.3
109 0.33
110 0.33
111 0.32
112 0.3
113 0.28
114 0.27
115 0.25
116 0.27
117 0.25
118 0.25
119 0.24
120 0.22
121 0.2
122 0.19
123 0.12
124 0.11
125 0.13
126 0.17
127 0.19
128 0.21
129 0.2
130 0.21
131 0.21
132 0.21
133 0.27
134 0.31
135 0.36
136 0.4
137 0.43
138 0.49
139 0.55
140 0.62
141 0.59
142 0.6
143 0.61
144 0.66
145 0.72
146 0.68
147 0.71
148 0.72
149 0.74
150 0.74