Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VKL7

Protein Details
Accession A0A1S8VKL7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSKSKNHTNHNQNKKAHRNGIKKPKANHydrophilic
NLS Segment(s)
PositionSequence
14-27KKAHRNGIKKPKAN
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHRNGIKKPKANMHVSLRGVDPKFRRNQRYAKKGSFAAFIASKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.82
4 0.81
5 0.79
6 0.8
7 0.84
8 0.83
9 0.79
10 0.75
11 0.73
12 0.7
13 0.65
14 0.61
15 0.55
16 0.53
17 0.48
18 0.44
19 0.37
20 0.36
21 0.32
22 0.31
23 0.28
24 0.29
25 0.37
26 0.44
27 0.5
28 0.52
29 0.62
30 0.67
31 0.75
32 0.76
33 0.74
34 0.71
35 0.68
36 0.63
37 0.56
38 0.46
39 0.41
40 0.34