Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XJ19

Protein Details
Accession B7XJ19    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-121KYNSTNNKKKTYKNSKTKYRIKFNKQNENIKNEIHydrophilic
NLS Segment(s)
PositionSequence
95-110KKKTYKNSKTKYRIKF
123-132TIKKKVKKFK
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MLENLDNIDDIKNAIKEAQIKSQGLKFEILKHYLLNYLLYKKLSENEKNNSSVINRLKECTILYKKLLEIEKYDLSNIDTEIIKKKIKYNSTNNKKKTYKNSKTKYRIKFNKQNENIKNEISTIKKKVKKFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.21
4 0.24
5 0.31
6 0.33
7 0.33
8 0.36
9 0.38
10 0.38
11 0.34
12 0.34
13 0.27
14 0.28
15 0.32
16 0.31
17 0.29
18 0.26
19 0.26
20 0.24
21 0.24
22 0.19
23 0.18
24 0.18
25 0.19
26 0.19
27 0.19
28 0.18
29 0.22
30 0.27
31 0.32
32 0.35
33 0.4
34 0.43
35 0.44
36 0.43
37 0.39
38 0.33
39 0.32
40 0.31
41 0.29
42 0.26
43 0.26
44 0.26
45 0.26
46 0.25
47 0.26
48 0.26
49 0.23
50 0.23
51 0.23
52 0.23
53 0.27
54 0.28
55 0.2
56 0.18
57 0.2
58 0.21
59 0.2
60 0.2
61 0.16
62 0.15
63 0.14
64 0.12
65 0.1
66 0.08
67 0.09
68 0.13
69 0.16
70 0.18
71 0.19
72 0.25
73 0.3
74 0.38
75 0.45
76 0.52
77 0.6
78 0.69
79 0.78
80 0.77
81 0.8
82 0.78
83 0.77
84 0.78
85 0.78
86 0.78
87 0.79
88 0.83
89 0.84
90 0.89
91 0.91
92 0.89
93 0.89
94 0.89
95 0.89
96 0.89
97 0.88
98 0.89
99 0.88
100 0.89
101 0.84
102 0.8
103 0.73
104 0.64
105 0.55
106 0.46
107 0.43
108 0.39
109 0.4
110 0.41
111 0.48
112 0.53