Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VZ29

Protein Details
Accession A0A1S8VZ29    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
210-232RTSVPTTKGGRRRRSGRTSITTNHydrophilic
NLS Segment(s)
PositionSequence
208-225RRRTSVPTTKGGRRRRSG
Subcellular Location(s) nucl 15, cyto 6.5, cyto_mito 5.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001842  Peptidase_M36  
IPR027268  Peptidase_M4/M1_CTD_sf  
Gene Ontology GO:0005615  C:extracellular space  
GO:0004222  F:metalloendopeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02128  Peptidase_M36  
Amino Acid Sequences MGEGWSDFFALVVTAKKQNRDVTPMSTGSFVTNSARGIRSHPYSTDTKINPLKFSDLKRLTEVHDVGEVWTMMLWEMYWNLVNKNGFSENLFDAKQSAGNVVAMQLVMGGLMNQPCNPTFISARDAILKADTSFYRGANKCDIISGFAKRGLGLNARNKNDDFSVPAECSGSGGGSQKTPGQTPDTPIGTPSRQPGGNPTTTTTLPRRRRTSVPTTKGGRRRRSGRTSITTNTTGGQTKRGGRTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.28
4 0.34
5 0.41
6 0.43
7 0.48
8 0.48
9 0.46
10 0.48
11 0.45
12 0.41
13 0.35
14 0.31
15 0.25
16 0.22
17 0.18
18 0.15
19 0.15
20 0.15
21 0.18
22 0.19
23 0.18
24 0.21
25 0.26
26 0.29
27 0.3
28 0.3
29 0.31
30 0.33
31 0.36
32 0.42
33 0.36
34 0.4
35 0.44
36 0.45
37 0.42
38 0.41
39 0.43
40 0.4
41 0.42
42 0.44
43 0.42
44 0.43
45 0.43
46 0.43
47 0.39
48 0.41
49 0.38
50 0.28
51 0.25
52 0.23
53 0.2
54 0.2
55 0.17
56 0.09
57 0.09
58 0.07
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.05
65 0.07
66 0.08
67 0.08
68 0.12
69 0.13
70 0.12
71 0.15
72 0.15
73 0.14
74 0.14
75 0.16
76 0.14
77 0.16
78 0.16
79 0.13
80 0.13
81 0.13
82 0.13
83 0.1
84 0.09
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.05
91 0.05
92 0.04
93 0.03
94 0.03
95 0.03
96 0.02
97 0.03
98 0.04
99 0.05
100 0.05
101 0.06
102 0.06
103 0.08
104 0.08
105 0.09
106 0.1
107 0.11
108 0.14
109 0.14
110 0.14
111 0.14
112 0.15
113 0.13
114 0.12
115 0.11
116 0.08
117 0.1
118 0.09
119 0.1
120 0.11
121 0.11
122 0.18
123 0.19
124 0.21
125 0.22
126 0.23
127 0.21
128 0.21
129 0.2
130 0.16
131 0.17
132 0.16
133 0.14
134 0.15
135 0.15
136 0.14
137 0.15
138 0.14
139 0.15
140 0.2
141 0.28
142 0.34
143 0.36
144 0.38
145 0.37
146 0.37
147 0.34
148 0.29
149 0.23
150 0.17
151 0.18
152 0.16
153 0.16
154 0.15
155 0.13
156 0.13
157 0.1
158 0.08
159 0.07
160 0.09
161 0.09
162 0.09
163 0.11
164 0.13
165 0.14
166 0.15
167 0.16
168 0.2
169 0.2
170 0.24
171 0.29
172 0.29
173 0.27
174 0.28
175 0.3
176 0.26
177 0.27
178 0.26
179 0.25
180 0.23
181 0.24
182 0.3
183 0.32
184 0.34
185 0.33
186 0.32
187 0.32
188 0.32
189 0.37
190 0.38
191 0.42
192 0.47
193 0.55
194 0.59
195 0.61
196 0.67
197 0.7
198 0.73
199 0.74
200 0.71
201 0.7
202 0.71
203 0.75
204 0.77
205 0.79
206 0.77
207 0.76
208 0.78
209 0.79
210 0.81
211 0.81
212 0.82
213 0.8
214 0.77
215 0.73
216 0.71
217 0.63
218 0.54
219 0.46
220 0.4
221 0.38
222 0.32
223 0.32
224 0.31
225 0.36
226 0.43