Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VJD7

Protein Details
Accession A0A1S8VJD7    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
125-154DRDYGRDRDYRRRSRSRSPRRAETTRARSPBasic
NLS Segment(s)
PositionSequence
131-165DRDYRRRSRSRSPRRAETTRARSPESRSRSRSRSR
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
Amino Acid Sequences MYLITALLIIFIGRYELQEDAEAAMEKLTTILVRGDTLSVEWATGERKTATDMRRADDSRNRYRQSNYDDDDDYYYRRRDGGRDYGRDRYRDSSRERDRDYGRDRDRDRDYGRDSRDRDSGRDRDRDYGRDRDYRRRSRSRSPRRAETTRARSPESRSRSRSRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.11
6 0.11
7 0.1
8 0.12
9 0.11
10 0.1
11 0.09
12 0.08
13 0.07
14 0.07
15 0.07
16 0.05
17 0.05
18 0.06
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.1
26 0.08
27 0.08
28 0.07
29 0.08
30 0.09
31 0.09
32 0.11
33 0.09
34 0.09
35 0.13
36 0.19
37 0.21
38 0.27
39 0.29
40 0.3
41 0.36
42 0.37
43 0.39
44 0.4
45 0.46
46 0.48
47 0.55
48 0.54
49 0.5
50 0.52
51 0.53
52 0.53
53 0.52
54 0.45
55 0.4
56 0.38
57 0.36
58 0.36
59 0.3
60 0.25
61 0.2
62 0.18
63 0.15
64 0.16
65 0.16
66 0.15
67 0.2
68 0.29
69 0.32
70 0.37
71 0.4
72 0.47
73 0.49
74 0.48
75 0.45
76 0.4
77 0.39
78 0.39
79 0.41
80 0.43
81 0.49
82 0.55
83 0.56
84 0.57
85 0.56
86 0.58
87 0.58
88 0.58
89 0.54
90 0.56
91 0.54
92 0.55
93 0.57
94 0.55
95 0.53
96 0.5
97 0.51
98 0.49
99 0.53
100 0.53
101 0.51
102 0.47
103 0.52
104 0.47
105 0.45
106 0.46
107 0.49
108 0.48
109 0.53
110 0.52
111 0.52
112 0.54
113 0.57
114 0.54
115 0.54
116 0.53
117 0.55
118 0.58
119 0.6
120 0.67
121 0.71
122 0.75
123 0.77
124 0.78
125 0.81
126 0.87
127 0.88
128 0.88
129 0.87
130 0.88
131 0.86
132 0.85
133 0.83
134 0.83
135 0.81
136 0.79
137 0.75
138 0.7
139 0.65
140 0.66
141 0.67
142 0.65
143 0.66
144 0.64
145 0.69