Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A9CT21

Protein Details
Accession A9CT21   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-35KDNSTTSKHIIKKRTTRKFYIKWFIFYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, plas 5, golg 3, E.R. 2, mito 1, cyto 1, pero 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
CDD cd19481  RecA-like_protease  
Amino Acid Sequences MYNSNVYNKDNSTTSKHIIKKRTTRKFYIKWFIFYTCILFPISLAILFYYDKMKIINKIYADLEEQEGNRLRELMFSRGCFVPQQVNNFENIEYFGKADFIFDKLKMYLPYIHIINSQPNSEVKKIINVENMGTFLLGPPGTGKTLFVKKFCYELNCLLKYFDYKYKNNPDQIKHFNLQNIKLTDKQKQDCQFYPNKVNLFVIRPSDLKFQWVGESEKAIKRLFNKIKTNIGSYEANVVFFDEAESLFSKRIMSSASKTIISEMMSEFLNQLNDMATNIQSIFFFAATNMEGSIDEAILRRFSKKIFFNNPVEQYRRDFLMNLLTNSKLSSLEIEQLVALTENRSFSFLESLCLKFKKIDFEGNYVGFDFQNAKDYAINEIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.53
4 0.58
5 0.64
6 0.7
7 0.73
8 0.78
9 0.84
10 0.83
11 0.85
12 0.87
13 0.87
14 0.87
15 0.88
16 0.81
17 0.76
18 0.71
19 0.64
20 0.56
21 0.47
22 0.41
23 0.3
24 0.27
25 0.22
26 0.18
27 0.15
28 0.15
29 0.14
30 0.1
31 0.09
32 0.08
33 0.09
34 0.1
35 0.11
36 0.11
37 0.11
38 0.11
39 0.14
40 0.17
41 0.21
42 0.25
43 0.29
44 0.28
45 0.3
46 0.31
47 0.31
48 0.29
49 0.25
50 0.23
51 0.21
52 0.2
53 0.22
54 0.26
55 0.25
56 0.23
57 0.23
58 0.2
59 0.23
60 0.26
61 0.27
62 0.26
63 0.26
64 0.29
65 0.28
66 0.29
67 0.25
68 0.24
69 0.26
70 0.26
71 0.31
72 0.33
73 0.33
74 0.34
75 0.34
76 0.32
77 0.23
78 0.23
79 0.18
80 0.14
81 0.13
82 0.11
83 0.11
84 0.11
85 0.12
86 0.1
87 0.11
88 0.13
89 0.13
90 0.15
91 0.15
92 0.18
93 0.17
94 0.19
95 0.2
96 0.2
97 0.23
98 0.21
99 0.22
100 0.21
101 0.22
102 0.25
103 0.22
104 0.21
105 0.19
106 0.22
107 0.25
108 0.24
109 0.25
110 0.2
111 0.25
112 0.27
113 0.28
114 0.29
115 0.26
116 0.26
117 0.23
118 0.23
119 0.17
120 0.14
121 0.11
122 0.07
123 0.08
124 0.06
125 0.06
126 0.06
127 0.07
128 0.08
129 0.08
130 0.09
131 0.12
132 0.2
133 0.23
134 0.23
135 0.26
136 0.26
137 0.29
138 0.29
139 0.28
140 0.25
141 0.3
142 0.36
143 0.33
144 0.33
145 0.31
146 0.3
147 0.28
148 0.27
149 0.27
150 0.26
151 0.27
152 0.35
153 0.44
154 0.49
155 0.53
156 0.56
157 0.53
158 0.54
159 0.59
160 0.56
161 0.48
162 0.45
163 0.42
164 0.39
165 0.37
166 0.35
167 0.31
168 0.27
169 0.31
170 0.32
171 0.35
172 0.39
173 0.39
174 0.4
175 0.43
176 0.47
177 0.43
178 0.46
179 0.45
180 0.43
181 0.46
182 0.43
183 0.38
184 0.34
185 0.32
186 0.28
187 0.25
188 0.22
189 0.18
190 0.16
191 0.16
192 0.17
193 0.21
194 0.19
195 0.18
196 0.17
197 0.16
198 0.16
199 0.17
200 0.18
201 0.14
202 0.17
203 0.18
204 0.2
205 0.23
206 0.21
207 0.21
208 0.21
209 0.31
210 0.36
211 0.41
212 0.46
213 0.47
214 0.54
215 0.54
216 0.54
217 0.44
218 0.41
219 0.33
220 0.26
221 0.29
222 0.21
223 0.2
224 0.17
225 0.16
226 0.12
227 0.11
228 0.11
229 0.05
230 0.05
231 0.06
232 0.07
233 0.07
234 0.08
235 0.08
236 0.08
237 0.08
238 0.09
239 0.1
240 0.12
241 0.15
242 0.2
243 0.22
244 0.22
245 0.22
246 0.22
247 0.21
248 0.19
249 0.17
250 0.12
251 0.11
252 0.1
253 0.11
254 0.1
255 0.1
256 0.1
257 0.08
258 0.08
259 0.07
260 0.07
261 0.07
262 0.08
263 0.07
264 0.07
265 0.07
266 0.08
267 0.07
268 0.08
269 0.08
270 0.07
271 0.07
272 0.06
273 0.07
274 0.07
275 0.08
276 0.07
277 0.07
278 0.07
279 0.07
280 0.08
281 0.06
282 0.06
283 0.07
284 0.08
285 0.1
286 0.11
287 0.13
288 0.14
289 0.16
290 0.23
291 0.29
292 0.38
293 0.45
294 0.52
295 0.57
296 0.63
297 0.69
298 0.67
299 0.65
300 0.58
301 0.53
302 0.48
303 0.43
304 0.36
305 0.29
306 0.24
307 0.31
308 0.31
309 0.29
310 0.29
311 0.27
312 0.26
313 0.26
314 0.25
315 0.16
316 0.13
317 0.14
318 0.13
319 0.17
320 0.17
321 0.17
322 0.16
323 0.15
324 0.15
325 0.13
326 0.11
327 0.08
328 0.09
329 0.11
330 0.11
331 0.13
332 0.13
333 0.13
334 0.2
335 0.18
336 0.21
337 0.23
338 0.25
339 0.3
340 0.31
341 0.31
342 0.29
343 0.32
344 0.37
345 0.38
346 0.45
347 0.43
348 0.49
349 0.53
350 0.49
351 0.48
352 0.39
353 0.36
354 0.26
355 0.23
356 0.2
357 0.15
358 0.21
359 0.2
360 0.21
361 0.22
362 0.23