Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8W3T4

Protein Details
Accession A0A1S8W3T4    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
125-156LRTKEAEKTNKNREKRLKRKKGNAKPKPVVVGBasic
NLS Segment(s)
PositionSequence
130-152AEKTNKNREKRLKRKKGNAKPKP
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSTNVKPKRPADATDSDEGGESNHGRKIRPKTILEAHKAQLDRLMNRVDKDIVLPNRPSDKPRAPRKEAAHIVRNIQGSSAGAGSGEFHVYRALRRKENTRLKALDDAAQREEDRQEYEKRQLDLRTKEAEKTNKNREKRLKRKKGNAKPKPVVVGPAPAPNTTMDDDQSNSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.39
4 0.35
5 0.31
6 0.24
7 0.19
8 0.15
9 0.14
10 0.17
11 0.18
12 0.2
13 0.28
14 0.36
15 0.42
16 0.48
17 0.48
18 0.52
19 0.6
20 0.66
21 0.65
22 0.61
23 0.54
24 0.51
25 0.49
26 0.41
27 0.37
28 0.33
29 0.28
30 0.26
31 0.3
32 0.27
33 0.28
34 0.3
35 0.25
36 0.21
37 0.22
38 0.26
39 0.24
40 0.27
41 0.27
42 0.28
43 0.33
44 0.34
45 0.34
46 0.34
47 0.4
48 0.45
49 0.55
50 0.61
51 0.61
52 0.68
53 0.69
54 0.71
55 0.7
56 0.66
57 0.62
58 0.54
59 0.51
60 0.47
61 0.43
62 0.33
63 0.25
64 0.2
65 0.13
66 0.12
67 0.1
68 0.05
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.06
77 0.07
78 0.1
79 0.18
80 0.22
81 0.26
82 0.29
83 0.35
84 0.44
85 0.54
86 0.56
87 0.54
88 0.52
89 0.5
90 0.52
91 0.47
92 0.41
93 0.34
94 0.32
95 0.26
96 0.26
97 0.23
98 0.2
99 0.2
100 0.16
101 0.17
102 0.18
103 0.22
104 0.24
105 0.32
106 0.36
107 0.36
108 0.39
109 0.41
110 0.46
111 0.46
112 0.47
113 0.47
114 0.43
115 0.46
116 0.5
117 0.53
118 0.53
119 0.57
120 0.64
121 0.65
122 0.69
123 0.75
124 0.78
125 0.81
126 0.83
127 0.86
128 0.86
129 0.88
130 0.93
131 0.95
132 0.95
133 0.95
134 0.94
135 0.93
136 0.89
137 0.84
138 0.79
139 0.69
140 0.63
141 0.54
142 0.5
143 0.41
144 0.41
145 0.37
146 0.31
147 0.31
148 0.27
149 0.29
150 0.25
151 0.24
152 0.19
153 0.2