Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XQ89

Protein Details
Accession B7XQ89    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKRTMKKLKREIKINKFFILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MKRTMKKLKREIKINKFFILIFKTLASELLFINPGAKPLKVANGPHPLTFLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.72
3 0.63
4 0.55
5 0.48
6 0.4
7 0.3
8 0.21
9 0.17
10 0.16
11 0.14
12 0.15
13 0.11
14 0.08
15 0.07
16 0.07
17 0.08
18 0.07
19 0.08
20 0.07
21 0.1
22 0.11
23 0.11
24 0.11
25 0.12
26 0.19
27 0.23
28 0.26
29 0.31
30 0.39
31 0.42
32 0.4