Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VMF7

Protein Details
Accession A0A1S8VMF7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-45SAKPGAKPCSGKKKGPKPSVDNSRGNHydrophilic
66-139QPQPVSQKQQPKQPRQPRQKPQPSRQPEQPKQQPQQQPKQPKQPDQPRQQPQQQQQPKPKQQPKQSKQPEQQQQHydrophilic
NLS Segment(s)
PositionSequence
32-33KK
Subcellular Location(s) extr 12, mito 8, nucl 2, pero 2, E.R. 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018244  Allrgn_V5/Tpx1_CS  
IPR014044  CAP_domain  
IPR035940  CAP_sf  
IPR001283  CRISP-related  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF00188  CAP  
PROSITE View protein in PROSITE  
PS01009  CRISP_1  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MARLIFIIYLLFIVGSSCVSAKPGAKPCSGKKKGPKPSVDNSRGNYPQPQPQPQPQPQPQPQPQPQPQPVSQKQQPKQPRQPRQKPQPSRQPEQPKQQPQQQPKQPKQPDQPRQQPQQQQQPKPKQQPKQSKQPEQQQQKPQPPRGPPRKSGVDYLGEFEQDCLDSHNEFRKTVGVNPVGWSRSAQTAAQTWANQLASTGKFKHSKGIFGKLGENLYRSSEPVYPCRQAIQSFFNERKFYNGQGIGQGDFPSYGHYTQVVWATTTQIGCALKGGITVCEYSPAGNIKGQTAPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.08
7 0.11
8 0.14
9 0.22
10 0.31
11 0.35
12 0.41
13 0.48
14 0.56
15 0.64
16 0.68
17 0.69
18 0.7
19 0.76
20 0.81
21 0.83
22 0.84
23 0.8
24 0.84
25 0.86
26 0.83
27 0.79
28 0.72
29 0.72
30 0.66
31 0.61
32 0.57
33 0.5
34 0.5
35 0.51
36 0.56
37 0.53
38 0.58
39 0.66
40 0.66
41 0.73
42 0.72
43 0.74
44 0.74
45 0.78
46 0.77
47 0.77
48 0.77
49 0.77
50 0.77
51 0.76
52 0.75
53 0.71
54 0.69
55 0.69
56 0.67
57 0.66
58 0.65
59 0.65
60 0.63
61 0.67
62 0.71
63 0.72
64 0.77
65 0.79
66 0.83
67 0.84
68 0.91
69 0.92
70 0.93
71 0.93
72 0.92
73 0.91
74 0.91
75 0.88
76 0.84
77 0.83
78 0.83
79 0.79
80 0.8
81 0.8
82 0.78
83 0.76
84 0.79
85 0.78
86 0.76
87 0.79
88 0.77
89 0.78
90 0.75
91 0.8
92 0.78
93 0.78
94 0.8
95 0.8
96 0.81
97 0.8
98 0.83
99 0.8
100 0.81
101 0.8
102 0.78
103 0.74
104 0.75
105 0.75
106 0.73
107 0.75
108 0.78
109 0.79
110 0.82
111 0.83
112 0.8
113 0.81
114 0.84
115 0.79
116 0.8
117 0.8
118 0.79
119 0.78
120 0.8
121 0.8
122 0.77
123 0.8
124 0.79
125 0.77
126 0.77
127 0.77
128 0.74
129 0.7
130 0.69
131 0.71
132 0.71
133 0.69
134 0.63
135 0.62
136 0.62
137 0.58
138 0.53
139 0.46
140 0.39
141 0.33
142 0.32
143 0.26
144 0.19
145 0.17
146 0.14
147 0.11
148 0.08
149 0.07
150 0.07
151 0.08
152 0.08
153 0.11
154 0.17
155 0.18
156 0.18
157 0.18
158 0.19
159 0.19
160 0.22
161 0.27
162 0.22
163 0.22
164 0.24
165 0.26
166 0.23
167 0.22
168 0.2
169 0.14
170 0.14
171 0.16
172 0.14
173 0.13
174 0.14
175 0.16
176 0.18
177 0.17
178 0.15
179 0.17
180 0.16
181 0.14
182 0.13
183 0.14
184 0.14
185 0.17
186 0.18
187 0.2
188 0.25
189 0.25
190 0.33
191 0.31
192 0.37
193 0.38
194 0.45
195 0.42
196 0.4
197 0.42
198 0.36
199 0.38
200 0.31
201 0.28
202 0.2
203 0.22
204 0.2
205 0.18
206 0.19
207 0.2
208 0.22
209 0.26
210 0.31
211 0.29
212 0.3
213 0.32
214 0.32
215 0.3
216 0.31
217 0.31
218 0.32
219 0.38
220 0.42
221 0.44
222 0.43
223 0.41
224 0.44
225 0.4
226 0.36
227 0.37
228 0.34
229 0.3
230 0.33
231 0.34
232 0.28
233 0.27
234 0.25
235 0.17
236 0.15
237 0.14
238 0.13
239 0.14
240 0.13
241 0.13
242 0.13
243 0.13
244 0.16
245 0.2
246 0.17
247 0.16
248 0.16
249 0.18
250 0.2
251 0.2
252 0.17
253 0.17
254 0.17
255 0.16
256 0.17
257 0.14
258 0.11
259 0.14
260 0.14
261 0.11
262 0.12
263 0.14
264 0.13
265 0.16
266 0.16
267 0.14
268 0.17
269 0.19
270 0.2
271 0.21
272 0.22
273 0.21