Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VIN5

Protein Details
Accession A0A1S8VIN5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
145-178SDPNDKTKESKTKKSKTKKPKTKQSKTKETEQSPHydrophilic
NLS Segment(s)
PositionSequence
152-170KESKTKKSKTKKPKTKQSK
Subcellular Location(s) nucl 15, mito_nucl 13, mito 9
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MKFNALVVAAMVITSVNAAGKGGFWSCFGLSCGPKSRVPRDRQVNEQQPGLSRVPRDSQVNEQQPAMPQNTAGNGQGSGSLRDLPDDELDEPQEPWFEESKGDGSNGPEVNVGLICYTADSALKYSHEQMEKIVSGSNNQQLVSSDPNDKTKESKTKKSKTKKPKTKQSKTKETEQSPSHYQPTPEQEERKCASLKENYDKAREEFVKYDCSAIYPDLLSPEKLTEMDKLFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.06
8 0.08
9 0.09
10 0.09
11 0.1
12 0.12
13 0.12
14 0.14
15 0.15
16 0.18
17 0.19
18 0.23
19 0.3
20 0.31
21 0.36
22 0.42
23 0.5
24 0.54
25 0.59
26 0.64
27 0.67
28 0.69
29 0.73
30 0.77
31 0.76
32 0.69
33 0.65
34 0.57
35 0.49
36 0.48
37 0.41
38 0.34
39 0.26
40 0.26
41 0.27
42 0.29
43 0.3
44 0.29
45 0.34
46 0.41
47 0.46
48 0.44
49 0.41
50 0.39
51 0.38
52 0.38
53 0.31
54 0.22
55 0.16
56 0.15
57 0.16
58 0.16
59 0.14
60 0.12
61 0.1
62 0.1
63 0.12
64 0.12
65 0.12
66 0.11
67 0.12
68 0.11
69 0.12
70 0.12
71 0.11
72 0.1
73 0.11
74 0.11
75 0.1
76 0.12
77 0.12
78 0.11
79 0.1
80 0.1
81 0.09
82 0.1
83 0.1
84 0.1
85 0.09
86 0.1
87 0.11
88 0.11
89 0.12
90 0.1
91 0.1
92 0.14
93 0.14
94 0.13
95 0.12
96 0.11
97 0.11
98 0.1
99 0.09
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.03
106 0.04
107 0.04
108 0.05
109 0.06
110 0.07
111 0.08
112 0.1
113 0.14
114 0.15
115 0.15
116 0.15
117 0.17
118 0.16
119 0.15
120 0.16
121 0.11
122 0.12
123 0.15
124 0.18
125 0.16
126 0.16
127 0.16
128 0.15
129 0.17
130 0.18
131 0.18
132 0.18
133 0.19
134 0.23
135 0.24
136 0.25
137 0.26
138 0.3
139 0.39
140 0.41
141 0.5
142 0.56
143 0.65
144 0.74
145 0.82
146 0.85
147 0.86
148 0.9
149 0.91
150 0.91
151 0.93
152 0.94
153 0.94
154 0.94
155 0.93
156 0.93
157 0.87
158 0.86
159 0.85
160 0.78
161 0.75
162 0.68
163 0.63
164 0.59
165 0.58
166 0.52
167 0.45
168 0.42
169 0.39
170 0.44
171 0.46
172 0.45
173 0.48
174 0.46
175 0.52
176 0.53
177 0.51
178 0.45
179 0.38
180 0.38
181 0.39
182 0.45
183 0.47
184 0.53
185 0.52
186 0.55
187 0.58
188 0.53
189 0.54
190 0.49
191 0.44
192 0.4
193 0.38
194 0.4
195 0.37
196 0.36
197 0.27
198 0.26
199 0.24
200 0.2
201 0.19
202 0.14
203 0.14
204 0.17
205 0.19
206 0.19
207 0.18
208 0.19
209 0.18
210 0.19
211 0.2
212 0.2