Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VAJ8

Protein Details
Accession A0A1S8VAJ8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
92-111ITNKLQKKLRQLQKDKVEMEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019152  DUF2046  
Pfam View protein in Pfam  
PF09755  DUF2046  
Amino Acid Sequences MALKAEVNELRSALEAENRITNKLRGDLQVEKGLVSTLRADKKALKQMAVNLQATAEVEEEYISNTLMKRIQQLQHEKGDLLIRVEAEEEMITNKLQKKLRQLQKDKVEMECVLEKEQEFMVNRLQKQLDDLRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.23
5 0.23
6 0.25
7 0.27
8 0.28
9 0.26
10 0.28
11 0.29
12 0.25
13 0.3
14 0.32
15 0.33
16 0.36
17 0.33
18 0.3
19 0.27
20 0.25
21 0.19
22 0.15
23 0.15
24 0.16
25 0.19
26 0.2
27 0.22
28 0.26
29 0.33
30 0.41
31 0.39
32 0.35
33 0.32
34 0.37
35 0.43
36 0.42
37 0.36
38 0.27
39 0.25
40 0.23
41 0.22
42 0.17
43 0.1
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.08
55 0.08
56 0.11
57 0.15
58 0.19
59 0.25
60 0.33
61 0.36
62 0.38
63 0.38
64 0.35
65 0.32
66 0.31
67 0.24
68 0.17
69 0.14
70 0.1
71 0.1
72 0.1
73 0.08
74 0.07
75 0.06
76 0.05
77 0.06
78 0.07
79 0.06
80 0.1
81 0.14
82 0.2
83 0.25
84 0.29
85 0.38
86 0.48
87 0.58
88 0.65
89 0.69
90 0.72
91 0.77
92 0.81
93 0.73
94 0.64
95 0.59
96 0.48
97 0.45
98 0.39
99 0.32
100 0.26
101 0.25
102 0.23
103 0.21
104 0.21
105 0.22
106 0.2
107 0.2
108 0.27
109 0.31
110 0.32
111 0.37
112 0.37
113 0.33
114 0.37