Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VHJ5

Protein Details
Accession A0A1S8VHJ5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
55-78AGPTKKELKAKERKEAKKKINRDDBasic
NLS Segment(s)
PositionSequence
58-75TKKELKAKERKEAKKKIN
Subcellular Location(s) mito 18.5, cyto_mito 11.5, nucl 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012098  SND3_fun  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0045047  P:protein targeting to ER  
Pfam View protein in Pfam  
PF10032  Pho88  
Amino Acid Sequences MHFKWGYLRPLFIQSIMSLWTLYCSPLVQIHYLGKPTVGELSRPFKGIATAGQTAGPTKKELKAKERKEAKKKINRDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.15
5 0.1
6 0.09
7 0.1
8 0.09
9 0.09
10 0.08
11 0.07
12 0.07
13 0.1
14 0.12
15 0.11
16 0.13
17 0.15
18 0.16
19 0.17
20 0.16
21 0.13
22 0.11
23 0.11
24 0.13
25 0.1
26 0.1
27 0.13
28 0.17
29 0.18
30 0.19
31 0.19
32 0.15
33 0.16
34 0.15
35 0.14
36 0.14
37 0.15
38 0.14
39 0.14
40 0.14
41 0.15
42 0.17
43 0.16
44 0.14
45 0.16
46 0.21
47 0.28
48 0.34
49 0.43
50 0.52
51 0.57
52 0.66
53 0.73
54 0.78
55 0.82
56 0.86
57 0.87
58 0.87