Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8W2A5

Protein Details
Accession A0A1S8W2A5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
88-114QRQQEIKRRIKAQKRANARRRIRTPEPHydrophilic
NLS Segment(s)
PositionSequence
94-110KRRIKAQKRANARRRIR
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009290  Radial_spoke_3  
Gene Ontology GO:0042995  C:cell projection  
GO:0005737  C:cytoplasm  
GO:0005856  C:cytoskeleton  
Pfam View protein in Pfam  
PF06098  Radial_spoke_3  
Amino Acid Sequences MLAGRPTQGLSAETEGAFDPNSTKQQGADAYTFVAEPRAMQPRRKARDLDESQGITANIMYDRRIHRGNTYASPTMLLNSQQDPVEVQRQQEIKRRIKAQKRANARRRIRTPEPVDGRQHIDVQTDLYLEELCDKVPEAVAATQTDAFINRAPSPLYIPEKSGVDTATQIYDGELFDFEFEITPILEVLIGKTIEQALMEVSEEQELAVLRSHQRKYEELRNAELVEVQRMESAELRRTEEKERRLAEQLRIIKEKQEVAEKIAAQAFSQSYLNGLIPNVFENLATNGYFYDVVEKEMETSVLPWLKSEIEKNMEQHFVACQIVDDLIRTHLRCPGQSQGVRDALSKIIDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.16
5 0.13
6 0.12
7 0.15
8 0.19
9 0.2
10 0.2
11 0.2
12 0.24
13 0.27
14 0.29
15 0.26
16 0.22
17 0.22
18 0.22
19 0.21
20 0.17
21 0.15
22 0.1
23 0.11
24 0.16
25 0.25
26 0.28
27 0.34
28 0.44
29 0.53
30 0.6
31 0.64
32 0.63
33 0.59
34 0.66
35 0.66
36 0.63
37 0.59
38 0.53
39 0.47
40 0.45
41 0.39
42 0.28
43 0.22
44 0.17
45 0.12
46 0.11
47 0.11
48 0.15
49 0.18
50 0.23
51 0.26
52 0.27
53 0.29
54 0.35
55 0.39
56 0.39
57 0.43
58 0.4
59 0.36
60 0.36
61 0.32
62 0.26
63 0.23
64 0.19
65 0.15
66 0.15
67 0.17
68 0.15
69 0.16
70 0.16
71 0.18
72 0.23
73 0.22
74 0.21
75 0.25
76 0.3
77 0.34
78 0.42
79 0.48
80 0.49
81 0.55
82 0.63
83 0.67
84 0.73
85 0.78
86 0.79
87 0.77
88 0.8
89 0.84
90 0.85
91 0.86
92 0.85
93 0.85
94 0.83
95 0.83
96 0.78
97 0.77
98 0.73
99 0.72
100 0.71
101 0.66
102 0.62
103 0.56
104 0.54
105 0.45
106 0.41
107 0.32
108 0.26
109 0.21
110 0.18
111 0.16
112 0.12
113 0.1
114 0.08
115 0.07
116 0.06
117 0.07
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.07
127 0.08
128 0.08
129 0.08
130 0.08
131 0.09
132 0.09
133 0.08
134 0.08
135 0.08
136 0.1
137 0.1
138 0.1
139 0.1
140 0.11
141 0.12
142 0.16
143 0.19
144 0.18
145 0.19
146 0.19
147 0.19
148 0.2
149 0.18
150 0.14
151 0.1
152 0.1
153 0.09
154 0.08
155 0.08
156 0.07
157 0.06
158 0.06
159 0.06
160 0.05
161 0.05
162 0.04
163 0.04
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.03
173 0.04
174 0.03
175 0.04
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.05
193 0.05
194 0.05
195 0.05
196 0.07
197 0.11
198 0.18
199 0.19
200 0.22
201 0.24
202 0.28
203 0.34
204 0.42
205 0.46
206 0.42
207 0.44
208 0.42
209 0.4
210 0.36
211 0.33
212 0.23
213 0.17
214 0.15
215 0.12
216 0.11
217 0.11
218 0.12
219 0.13
220 0.15
221 0.18
222 0.19
223 0.23
224 0.25
225 0.28
226 0.35
227 0.39
228 0.42
229 0.45
230 0.45
231 0.45
232 0.5
233 0.51
234 0.47
235 0.48
236 0.49
237 0.47
238 0.49
239 0.45
240 0.42
241 0.4
242 0.39
243 0.33
244 0.34
245 0.3
246 0.3
247 0.34
248 0.31
249 0.3
250 0.29
251 0.26
252 0.18
253 0.2
254 0.16
255 0.13
256 0.14
257 0.11
258 0.1
259 0.11
260 0.11
261 0.1
262 0.1
263 0.09
264 0.09
265 0.1
266 0.1
267 0.09
268 0.09
269 0.09
270 0.11
271 0.12
272 0.11
273 0.1
274 0.09
275 0.11
276 0.11
277 0.1
278 0.14
279 0.12
280 0.14
281 0.15
282 0.15
283 0.15
284 0.15
285 0.16
286 0.1
287 0.1
288 0.14
289 0.17
290 0.17
291 0.15
292 0.17
293 0.19
294 0.22
295 0.25
296 0.26
297 0.28
298 0.31
299 0.34
300 0.37
301 0.37
302 0.34
303 0.31
304 0.26
305 0.23
306 0.2
307 0.16
308 0.12
309 0.11
310 0.12
311 0.11
312 0.11
313 0.1
314 0.14
315 0.19
316 0.19
317 0.2
318 0.25
319 0.28
320 0.29
321 0.33
322 0.37
323 0.42
324 0.45
325 0.48
326 0.49
327 0.51
328 0.5
329 0.47
330 0.4
331 0.33