Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XJ22

Protein Details
Accession B7XJ22    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-37AAQEKRTHDKVYRKRQQGKIYKSVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
Amino Acid Sequences MRGLFAAYALRKAAQEKRTHDKVYRKRQQGKIYKSVIGNKPQANAIVLDKLGVEAKQPNSAVRKVCRVQCIATRRTVFAFAPGDGALKVIDPNDEVTIQSLGRSGKSVGDRPGIKYEIIKVAGVSLDAILKGKREKPTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.44
4 0.52
5 0.59
6 0.62
7 0.65
8 0.67
9 0.71
10 0.74
11 0.77
12 0.78
13 0.81
14 0.84
15 0.87
16 0.87
17 0.84
18 0.82
19 0.76
20 0.71
21 0.65
22 0.65
23 0.6
24 0.57
25 0.55
26 0.47
27 0.45
28 0.41
29 0.37
30 0.29
31 0.25
32 0.19
33 0.14
34 0.12
35 0.11
36 0.1
37 0.09
38 0.09
39 0.08
40 0.08
41 0.1
42 0.11
43 0.14
44 0.15
45 0.17
46 0.2
47 0.24
48 0.26
49 0.25
50 0.31
51 0.31
52 0.34
53 0.35
54 0.33
55 0.32
56 0.35
57 0.39
58 0.34
59 0.36
60 0.33
61 0.31
62 0.3
63 0.3
64 0.23
65 0.21
66 0.2
67 0.14
68 0.14
69 0.13
70 0.13
71 0.11
72 0.11
73 0.07
74 0.06
75 0.06
76 0.05
77 0.05
78 0.06
79 0.07
80 0.08
81 0.08
82 0.08
83 0.09
84 0.1
85 0.09
86 0.09
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11
92 0.14
93 0.18
94 0.22
95 0.24
96 0.3
97 0.32
98 0.34
99 0.39
100 0.36
101 0.33
102 0.3
103 0.3
104 0.29
105 0.29
106 0.25
107 0.19
108 0.19
109 0.19
110 0.17
111 0.14
112 0.08
113 0.07
114 0.08
115 0.09
116 0.09
117 0.13
118 0.18
119 0.24