Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8W5N2

Protein Details
Accession A0A1S8W5N2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-49ALNKIEIVKKRTKRFSRHQSDRYHKIDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-48KKRTKRFSRHQSDRYHKIDASWRKPKGIDNRVRRRFK
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPVALNKIEIVKKRTKRFSRHQSDRYHKIDASWRKPKGIDNRVRRRFKGQIAMPKIGYGSNSKTRHIMPNGFKKFLVNNVQDLELLLMHNRVFAAEIAHNVSSKKRATIVERARQLDVKVTNAGGRLRTAENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.76
4 0.81
5 0.86
6 0.87
7 0.89
8 0.88
9 0.88
10 0.88
11 0.87
12 0.81
13 0.74
14 0.63
15 0.56
16 0.57
17 0.57
18 0.57
19 0.57
20 0.55
21 0.52
22 0.54
23 0.58
24 0.59
25 0.59
26 0.59
27 0.61
28 0.7
29 0.77
30 0.82
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.58
40 0.5
41 0.44
42 0.38
43 0.29
44 0.24
45 0.17
46 0.16
47 0.23
48 0.24
49 0.25
50 0.26
51 0.28
52 0.32
53 0.33
54 0.35
55 0.33
56 0.42
57 0.45
58 0.44
59 0.42
60 0.38
61 0.36
62 0.35
63 0.35
64 0.26
65 0.25
66 0.24
67 0.25
68 0.24
69 0.23
70 0.17
71 0.09
72 0.08
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.09
82 0.08
83 0.1
84 0.12
85 0.13
86 0.14
87 0.13
88 0.15
89 0.18
90 0.18
91 0.19
92 0.2
93 0.24
94 0.29
95 0.39
96 0.47
97 0.51
98 0.57
99 0.58
100 0.57
101 0.55
102 0.5
103 0.47
104 0.39
105 0.33
106 0.28
107 0.26
108 0.26
109 0.27
110 0.28
111 0.22
112 0.21
113 0.22