Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VID7

Protein Details
Accession A0A1S8VID7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-104KRYLKYLTKKYLKKNQLRDWLRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MSAAVAKSAVKSRKDQKKVATKLTIDVSAPSLDGIFDISAYEKYLHDRIKVAGRTSNLSDSITISCTETVLTITVSPNVQFAKRYLKYLTKKYLKKNQLRDWLRVVSSGKTAYTVKYFNIANAEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.68
4 0.73
5 0.77
6 0.78
7 0.75
8 0.65
9 0.62
10 0.59
11 0.5
12 0.4
13 0.33
14 0.26
15 0.19
16 0.17
17 0.13
18 0.09
19 0.07
20 0.07
21 0.07
22 0.05
23 0.04
24 0.05
25 0.06
26 0.06
27 0.07
28 0.08
29 0.08
30 0.11
31 0.16
32 0.18
33 0.18
34 0.19
35 0.2
36 0.27
37 0.29
38 0.27
39 0.26
40 0.25
41 0.26
42 0.27
43 0.26
44 0.19
45 0.17
46 0.16
47 0.14
48 0.13
49 0.11
50 0.1
51 0.09
52 0.08
53 0.07
54 0.07
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.09
67 0.1
68 0.11
69 0.2
70 0.21
71 0.24
72 0.27
73 0.35
74 0.41
75 0.48
76 0.57
77 0.56
78 0.62
79 0.69
80 0.75
81 0.77
82 0.79
83 0.81
84 0.81
85 0.82
86 0.8
87 0.75
88 0.71
89 0.65
90 0.56
91 0.5
92 0.43
93 0.34
94 0.33
95 0.29
96 0.23
97 0.22
98 0.22
99 0.21
100 0.23
101 0.23
102 0.2
103 0.24
104 0.24
105 0.23
106 0.27
107 0.25