Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VXZ2

Protein Details
Accession A0A1S8VXZ2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-91GMPPRSKTPPPTRPKPKISSKPYNIHydrophilic
NLS Segment(s)
PositionSequence
70-83PRSKTPPPTRPKPK
Subcellular Location(s) extr 18, mito 3, golg 3, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MKPFILTFVAILTTSTATLAFPTVTYAGQSFLERRADDDDRPTKTKSALMPRYSKTPLMPPPSKATGMPPRSKTPPPTRPKPKISSKPYNIQGNDQSDNAVDDSEASGGGYASKDQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.08
7 0.06
8 0.06
9 0.08
10 0.08
11 0.08
12 0.09
13 0.09
14 0.1
15 0.1
16 0.12
17 0.11
18 0.14
19 0.18
20 0.17
21 0.18
22 0.22
23 0.24
24 0.24
25 0.31
26 0.34
27 0.35
28 0.38
29 0.38
30 0.33
31 0.32
32 0.34
33 0.32
34 0.36
35 0.39
36 0.41
37 0.45
38 0.45
39 0.49
40 0.47
41 0.42
42 0.33
43 0.32
44 0.33
45 0.35
46 0.36
47 0.33
48 0.36
49 0.37
50 0.37
51 0.31
52 0.31
53 0.32
54 0.37
55 0.41
56 0.4
57 0.42
58 0.46
59 0.49
60 0.51
61 0.52
62 0.56
63 0.59
64 0.66
65 0.72
66 0.76
67 0.8
68 0.81
69 0.81
70 0.82
71 0.82
72 0.83
73 0.78
74 0.79
75 0.78
76 0.78
77 0.69
78 0.64
79 0.61
80 0.56
81 0.52
82 0.43
83 0.36
84 0.27
85 0.27
86 0.22
87 0.15
88 0.09
89 0.08
90 0.08
91 0.08
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07