Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8WA94

Protein Details
Accession A0A1S8WA94   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
168-195DISSRWMTYRHEWRRRQKWFNTAWQQIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010776  Hop2_WH_dom  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0090304  P:nucleic acid metabolic process  
Pfam View protein in Pfam  
PF07106  TBPIP  
Amino Acid Sequences MARTAAPVKIQQQDVSGDTQALNTIIAYLHKQNRPYNSTDIFNNLKGSISKTCLLKILSLCTEQQLIQSKTYGKSVIYAPIQYDETPDASDKVATTASALELANKDLVMHRETLKTLTNELAKLSKSLPTCEAKAKLDQINQRNDLLTRRLEILSNGKCLASPEQCRDISSRWMTYRHEWRRRQKWFNTAWQQIFDGSREEGINLMVYLQILLFVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.26
4 0.21
5 0.18
6 0.17
7 0.16
8 0.13
9 0.11
10 0.07
11 0.07
12 0.07
13 0.08
14 0.11
15 0.17
16 0.25
17 0.29
18 0.35
19 0.4
20 0.47
21 0.5
22 0.52
23 0.52
24 0.48
25 0.47
26 0.42
27 0.43
28 0.38
29 0.35
30 0.32
31 0.25
32 0.23
33 0.21
34 0.23
35 0.21
36 0.21
37 0.23
38 0.23
39 0.23
40 0.25
41 0.25
42 0.25
43 0.23
44 0.24
45 0.22
46 0.23
47 0.22
48 0.2
49 0.2
50 0.17
51 0.2
52 0.24
53 0.23
54 0.22
55 0.24
56 0.26
57 0.26
58 0.27
59 0.24
60 0.15
61 0.16
62 0.16
63 0.19
64 0.18
65 0.17
66 0.16
67 0.17
68 0.18
69 0.16
70 0.16
71 0.12
72 0.11
73 0.11
74 0.11
75 0.1
76 0.09
77 0.09
78 0.08
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.05
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.09
95 0.08
96 0.1
97 0.1
98 0.11
99 0.12
100 0.14
101 0.15
102 0.14
103 0.14
104 0.16
105 0.16
106 0.15
107 0.16
108 0.16
109 0.13
110 0.14
111 0.13
112 0.15
113 0.14
114 0.16
115 0.19
116 0.2
117 0.22
118 0.25
119 0.28
120 0.26
121 0.28
122 0.31
123 0.3
124 0.33
125 0.39
126 0.4
127 0.44
128 0.44
129 0.42
130 0.38
131 0.36
132 0.33
133 0.29
134 0.24
135 0.18
136 0.19
137 0.19
138 0.18
139 0.2
140 0.25
141 0.24
142 0.26
143 0.25
144 0.22
145 0.22
146 0.23
147 0.26
148 0.25
149 0.27
150 0.3
151 0.36
152 0.36
153 0.37
154 0.38
155 0.36
156 0.38
157 0.37
158 0.37
159 0.34
160 0.38
161 0.4
162 0.46
163 0.54
164 0.56
165 0.62
166 0.66
167 0.74
168 0.81
169 0.87
170 0.89
171 0.86
172 0.85
173 0.82
174 0.84
175 0.83
176 0.81
177 0.73
178 0.66
179 0.59
180 0.51
181 0.45
182 0.35
183 0.28
184 0.2
185 0.2
186 0.17
187 0.17
188 0.14
189 0.13
190 0.13
191 0.1
192 0.09
193 0.07
194 0.07
195 0.07
196 0.06