Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VE98

Protein Details
Accession A0A1S8VE98    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
95-121LTLHHGTTRYKCKRRKATGQKKTYTYIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences RKERMHRSDIPNNKKKYMSVLMHIGFGGGGGGGGRGKNQSIPKMTSTLLDSYRPIGSQTPSVMIMTLAYFLYESDHKGEWAVIYRTSRDKIDPVLTLHHGTTRYKCKRRKATGQKKTYTYIYTYLYIYYCDYYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.6
3 0.57
4 0.56
5 0.49
6 0.45
7 0.47
8 0.43
9 0.42
10 0.4
11 0.32
12 0.22
13 0.18
14 0.13
15 0.04
16 0.03
17 0.03
18 0.03
19 0.04
20 0.04
21 0.05
22 0.06
23 0.07
24 0.12
25 0.16
26 0.21
27 0.24
28 0.27
29 0.28
30 0.3
31 0.29
32 0.26
33 0.24
34 0.22
35 0.2
36 0.18
37 0.17
38 0.17
39 0.17
40 0.16
41 0.14
42 0.13
43 0.13
44 0.13
45 0.13
46 0.12
47 0.12
48 0.12
49 0.11
50 0.09
51 0.08
52 0.06
53 0.06
54 0.05
55 0.04
56 0.04
57 0.04
58 0.05
59 0.06
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.12
68 0.12
69 0.12
70 0.13
71 0.16
72 0.19
73 0.21
74 0.21
75 0.19
76 0.2
77 0.21
78 0.23
79 0.23
80 0.21
81 0.23
82 0.24
83 0.24
84 0.23
85 0.22
86 0.21
87 0.21
88 0.27
89 0.34
90 0.42
91 0.5
92 0.58
93 0.66
94 0.74
95 0.82
96 0.86
97 0.87
98 0.88
99 0.89
100 0.92
101 0.89
102 0.82
103 0.77
104 0.7
105 0.61
106 0.53
107 0.47
108 0.4
109 0.35
110 0.31
111 0.28
112 0.24
113 0.22
114 0.21