Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A9CST2

Protein Details
Accession A9CST2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
152-181DDKYNKKYSKDDYKHSKRRKPNYYNGYKRFBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences MDKNEFLLSSNESDENSSDISLIIDKAQEGELQIEQMEDNNAYNVDIEKIKDKPWLKPGADITDYFNYGFTEKTWLKYCQMQKERRGFVEKYQDTKNLDNSLKECKTIIKNDTIKNQDTKDYDNKTNYNKKNYTTSKNSEDTDYNNHNKQYDDKYNKKYSKDDYKHSKRRKPNYYNGYKRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.16
4 0.13
5 0.11
6 0.1
7 0.1
8 0.1
9 0.09
10 0.08
11 0.08
12 0.08
13 0.09
14 0.09
15 0.09
16 0.09
17 0.11
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.09
33 0.1
34 0.1
35 0.13
36 0.14
37 0.16
38 0.23
39 0.25
40 0.29
41 0.35
42 0.43
43 0.4
44 0.44
45 0.46
46 0.45
47 0.44
48 0.39
49 0.35
50 0.29
51 0.29
52 0.23
53 0.2
54 0.15
55 0.13
56 0.13
57 0.09
58 0.14
59 0.14
60 0.17
61 0.2
62 0.21
63 0.23
64 0.3
65 0.34
66 0.38
67 0.46
68 0.5
69 0.54
70 0.61
71 0.62
72 0.57
73 0.58
74 0.48
75 0.45
76 0.49
77 0.42
78 0.38
79 0.37
80 0.38
81 0.36
82 0.37
83 0.35
84 0.29
85 0.28
86 0.26
87 0.26
88 0.3
89 0.27
90 0.26
91 0.23
92 0.22
93 0.25
94 0.29
95 0.3
96 0.31
97 0.36
98 0.39
99 0.46
100 0.46
101 0.44
102 0.43
103 0.42
104 0.38
105 0.34
106 0.36
107 0.37
108 0.38
109 0.41
110 0.42
111 0.45
112 0.49
113 0.57
114 0.58
115 0.59
116 0.57
117 0.55
118 0.6
119 0.63
120 0.62
121 0.61
122 0.61
123 0.58
124 0.59
125 0.58
126 0.51
127 0.46
128 0.41
129 0.41
130 0.42
131 0.41
132 0.4
133 0.41
134 0.39
135 0.38
136 0.4
137 0.41
138 0.45
139 0.49
140 0.54
141 0.61
142 0.7
143 0.75
144 0.74
145 0.72
146 0.7
147 0.72
148 0.7
149 0.71
150 0.72
151 0.78
152 0.84
153 0.88
154 0.88
155 0.88
156 0.91
157 0.92
158 0.91
159 0.91
160 0.91
161 0.92