Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VWV7

Protein Details
Accession A0A1S8VWV7   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
49-72EIHPKNTPKKTQKKTQSSNKIIKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13.833, nucl 9, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MTENYHRSVSFSGFSKGSSVYTFWNPPPPTHTHTRERKMPNDKRDEKQEIHPKNTPKKTQKKTQSSNKIIKTSRGTLCIICATLAQKPIDIRHSPFPGKNLPECFLFEHITMNPCLFYRLLIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.2
4 0.19
5 0.17
6 0.15
7 0.16
8 0.2
9 0.23
10 0.23
11 0.32
12 0.31
13 0.31
14 0.34
15 0.36
16 0.37
17 0.42
18 0.47
19 0.48
20 0.56
21 0.62
22 0.66
23 0.67
24 0.7
25 0.73
26 0.75
27 0.75
28 0.76
29 0.76
30 0.72
31 0.74
32 0.71
33 0.63
34 0.64
35 0.64
36 0.59
37 0.58
38 0.58
39 0.57
40 0.61
41 0.65
42 0.64
43 0.65
44 0.7
45 0.71
46 0.75
47 0.78
48 0.78
49 0.8
50 0.82
51 0.82
52 0.8
53 0.82
54 0.77
55 0.74
56 0.65
57 0.61
58 0.55
59 0.5
60 0.44
61 0.39
62 0.36
63 0.29
64 0.29
65 0.25
66 0.2
67 0.14
68 0.13
69 0.11
70 0.12
71 0.15
72 0.13
73 0.14
74 0.15
75 0.18
76 0.23
77 0.24
78 0.26
79 0.3
80 0.36
81 0.38
82 0.39
83 0.41
84 0.42
85 0.44
86 0.46
87 0.43
88 0.39
89 0.37
90 0.37
91 0.36
92 0.32
93 0.3
94 0.24
95 0.23
96 0.23
97 0.24
98 0.22
99 0.2
100 0.17
101 0.15
102 0.17
103 0.14