Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VM71

Protein Details
Accession A0A1S8VM71   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
63-82DDKPPPKKSSKKYSKAKDGEBasic
88-120AEEKPKETKKPPPKEEPKKPSRWSKLWNKAKGFBasic
NLS Segment(s)
PositionSequence
66-79PPPKKSSKKYSKAK
89-119EEKPKETKKPPPKEEPKKPSRWSKLWNKAKG
Subcellular Location(s) extr 14, cyto 3, golg 3, mito 2, E.R. 2, vacu 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MKFIILLAVSLFAVTVNAAAIPAMLNPQSLVVLERRSPAPSTKSKSSSADDEEGEADDSSESDDKPPPKKSSKKYSKAKDGEEDEEEAEEKPKETKKPPPKEEPKKPSRWSKLWNKAKGFGKQTASNLGQSFLNKQGAGGSGGGGGEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.06
11 0.06
12 0.06
13 0.06
14 0.07
15 0.07
16 0.07
17 0.09
18 0.09
19 0.12
20 0.13
21 0.16
22 0.17
23 0.18
24 0.2
25 0.23
26 0.27
27 0.33
28 0.39
29 0.43
30 0.46
31 0.47
32 0.49
33 0.48
34 0.46
35 0.42
36 0.38
37 0.31
38 0.28
39 0.25
40 0.21
41 0.19
42 0.14
43 0.1
44 0.07
45 0.06
46 0.07
47 0.07
48 0.06
49 0.07
50 0.11
51 0.15
52 0.2
53 0.26
54 0.3
55 0.38
56 0.47
57 0.53
58 0.61
59 0.67
60 0.73
61 0.77
62 0.8
63 0.81
64 0.78
65 0.73
66 0.68
67 0.61
68 0.54
69 0.46
70 0.39
71 0.29
72 0.24
73 0.21
74 0.15
75 0.13
76 0.1
77 0.09
78 0.11
79 0.15
80 0.2
81 0.24
82 0.35
83 0.44
84 0.54
85 0.61
86 0.69
87 0.76
88 0.82
89 0.88
90 0.88
91 0.87
92 0.86
93 0.86
94 0.86
95 0.84
96 0.8
97 0.79
98 0.79
99 0.81
100 0.81
101 0.82
102 0.76
103 0.75
104 0.75
105 0.73
106 0.67
107 0.63
108 0.59
109 0.55
110 0.53
111 0.52
112 0.47
113 0.43
114 0.38
115 0.33
116 0.29
117 0.26
118 0.27
119 0.25
120 0.26
121 0.22
122 0.21
123 0.22
124 0.21
125 0.21
126 0.18
127 0.13
128 0.11
129 0.11