Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2L4N7

Protein Details
Accession A0A1V2L4N7   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-62ESKKAVPKVKRVKKETTPPVHydrophilic
NLS Segment(s)
PositionSequence
45-56KKAVPKVKRVKK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Gene Ontology GO:0003677  F:DNA binding  
GO:0006974  P:DNA damage response  
Amino Acid Sequences MALSEFEKQRQANIERNKKLLNSLNLNQINSSIAKRVKQEDDESKKAVPKVKRVKKETTPPVATRRSARLAGVKIEDTDSVIKHEVDLEKLRKEEMEKLKRIRINGNLSLVDLLKEENGDVKTEEDGDDSKILEKFKSMIGNGSRAFSAGDYYEQIKKSEGNTSKDVQQLRDQFDKFTIWEHFEPKNIALTPERTYYTCFHPTVDKNLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.64
4 0.64
5 0.56
6 0.58
7 0.57
8 0.55
9 0.52
10 0.5
11 0.56
12 0.56
13 0.55
14 0.47
15 0.39
16 0.33
17 0.27
18 0.25
19 0.21
20 0.21
21 0.24
22 0.27
23 0.33
24 0.36
25 0.39
26 0.45
27 0.5
28 0.55
29 0.57
30 0.55
31 0.52
32 0.51
33 0.5
34 0.5
35 0.44
36 0.46
37 0.53
38 0.6
39 0.67
40 0.69
41 0.74
42 0.75
43 0.8
44 0.79
45 0.78
46 0.74
47 0.69
48 0.7
49 0.66
50 0.6
51 0.53
52 0.49
53 0.43
54 0.38
55 0.36
56 0.34
57 0.31
58 0.31
59 0.3
60 0.25
61 0.21
62 0.21
63 0.19
64 0.14
65 0.14
66 0.11
67 0.11
68 0.12
69 0.11
70 0.1
71 0.13
72 0.12
73 0.13
74 0.19
75 0.19
76 0.2
77 0.21
78 0.21
79 0.19
80 0.2
81 0.26
82 0.31
83 0.36
84 0.4
85 0.43
86 0.49
87 0.5
88 0.5
89 0.46
90 0.42
91 0.4
92 0.37
93 0.36
94 0.31
95 0.29
96 0.28
97 0.23
98 0.16
99 0.1
100 0.08
101 0.05
102 0.05
103 0.05
104 0.07
105 0.08
106 0.08
107 0.08
108 0.09
109 0.09
110 0.1
111 0.1
112 0.08
113 0.08
114 0.09
115 0.09
116 0.08
117 0.1
118 0.12
119 0.12
120 0.11
121 0.11
122 0.11
123 0.13
124 0.16
125 0.14
126 0.18
127 0.2
128 0.25
129 0.25
130 0.25
131 0.22
132 0.19
133 0.19
134 0.13
135 0.12
136 0.08
137 0.09
138 0.09
139 0.12
140 0.16
141 0.17
142 0.18
143 0.18
144 0.19
145 0.2
146 0.28
147 0.31
148 0.32
149 0.35
150 0.37
151 0.41
152 0.44
153 0.44
154 0.38
155 0.39
156 0.4
157 0.42
158 0.47
159 0.43
160 0.39
161 0.39
162 0.38
163 0.31
164 0.29
165 0.26
166 0.24
167 0.26
168 0.3
169 0.29
170 0.31
171 0.33
172 0.3
173 0.33
174 0.28
175 0.28
176 0.28
177 0.3
178 0.3
179 0.31
180 0.33
181 0.28
182 0.31
183 0.3
184 0.33
185 0.37
186 0.34
187 0.32
188 0.38
189 0.41