Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061BA06

Protein Details
Accession A0A061BA06    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
87-113DAEPAKKAKKEMRARNKKQIKMNNFMSHydrophilic
NLS Segment(s)
PositionSequence
91-105AKKAKKEMRARNKKQ
Subcellular Location(s) mito 25, mito_nucl 13.833, cyto_mito 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFALTRRSIAFTFSRRAFATSSVLRNAAKAAEVEASTPAIKSSCPAGTVLNLKIKKSGAEPVALEDSEYPEWLWTVLDSKAQQAKLDAEPAKKAKKEMRARNKKQIKMNNFMSQMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.36
4 0.34
5 0.3
6 0.32
7 0.29
8 0.31
9 0.29
10 0.3
11 0.28
12 0.27
13 0.25
14 0.19
15 0.15
16 0.11
17 0.1
18 0.1
19 0.1
20 0.1
21 0.1
22 0.11
23 0.1
24 0.1
25 0.09
26 0.07
27 0.07
28 0.07
29 0.09
30 0.09
31 0.09
32 0.1
33 0.1
34 0.13
35 0.16
36 0.18
37 0.22
38 0.22
39 0.22
40 0.23
41 0.22
42 0.21
43 0.19
44 0.21
45 0.15
46 0.16
47 0.16
48 0.16
49 0.17
50 0.16
51 0.15
52 0.1
53 0.12
54 0.1
55 0.1
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.05
62 0.06
63 0.07
64 0.1
65 0.1
66 0.15
67 0.19
68 0.2
69 0.2
70 0.2
71 0.23
72 0.21
73 0.28
74 0.27
75 0.25
76 0.3
77 0.36
78 0.41
79 0.39
80 0.44
81 0.44
82 0.5
83 0.59
84 0.64
85 0.7
86 0.74
87 0.81
88 0.87
89 0.9
90 0.87
91 0.87
92 0.86
93 0.83
94 0.8
95 0.79
96 0.77