Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XQL1

Protein Details
Accession B7XQL1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
260-281LFVFMQETKRSRRFRKRMENDLHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
Gene Ontology GO:0000502  C:proteasome complex  
Pfam View protein in Pfam  
PF13646  HEAT_2  
Amino Acid Sequences MISGDMSAPELDNNDVVVIEETILRLGVNYVNSNEACIIDYLLKYVNHSNDDIKRAAVISLGMVIGYHEESIREIMIPLSTSHAMYVRAAVALSLGFFSTEVTDVGLKADIINLLEALIFDSEDLVKQQAGIGLGIALQQHNTNLYGTKDCATVNYKRICKMMNGIIGNRNDSRSYKIGVGLGRSLMELGGRNAVLSLRNISGRIDNMRVHGYLLFTQSWYWNPLYNFLSLLVLPTPCIRVDKSLQLAQTTGIQSGYRELFVFMQETKRSRRFRKRMENDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.06
13 0.07
14 0.09
15 0.11
16 0.13
17 0.14
18 0.18
19 0.18
20 0.19
21 0.18
22 0.16
23 0.14
24 0.13
25 0.13
26 0.11
27 0.11
28 0.11
29 0.15
30 0.14
31 0.16
32 0.21
33 0.23
34 0.23
35 0.25
36 0.31
37 0.32
38 0.36
39 0.34
40 0.29
41 0.26
42 0.24
43 0.22
44 0.16
45 0.11
46 0.07
47 0.07
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.07
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.1
67 0.11
68 0.11
69 0.11
70 0.12
71 0.12
72 0.11
73 0.12
74 0.09
75 0.08
76 0.08
77 0.07
78 0.06
79 0.05
80 0.05
81 0.04
82 0.04
83 0.03
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.06
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.06
130 0.05
131 0.07
132 0.08
133 0.09
134 0.09
135 0.1
136 0.11
137 0.1
138 0.12
139 0.15
140 0.17
141 0.23
142 0.29
143 0.3
144 0.31
145 0.32
146 0.31
147 0.28
148 0.29
149 0.27
150 0.26
151 0.26
152 0.26
153 0.3
154 0.3
155 0.31
156 0.28
157 0.24
158 0.2
159 0.2
160 0.22
161 0.19
162 0.2
163 0.19
164 0.19
165 0.21
166 0.2
167 0.21
168 0.17
169 0.15
170 0.13
171 0.12
172 0.11
173 0.08
174 0.07
175 0.07
176 0.07
177 0.08
178 0.07
179 0.07
180 0.08
181 0.08
182 0.09
183 0.09
184 0.1
185 0.1
186 0.11
187 0.12
188 0.13
189 0.14
190 0.16
191 0.18
192 0.19
193 0.19
194 0.2
195 0.22
196 0.21
197 0.2
198 0.19
199 0.17
200 0.15
201 0.17
202 0.15
203 0.13
204 0.14
205 0.15
206 0.16
207 0.17
208 0.16
209 0.18
210 0.18
211 0.23
212 0.24
213 0.23
214 0.22
215 0.19
216 0.2
217 0.15
218 0.16
219 0.12
220 0.1
221 0.11
222 0.11
223 0.12
224 0.12
225 0.15
226 0.14
227 0.18
228 0.22
229 0.29
230 0.34
231 0.36
232 0.36
233 0.35
234 0.34
235 0.3
236 0.31
237 0.24
238 0.19
239 0.17
240 0.16
241 0.15
242 0.19
243 0.2
244 0.15
245 0.15
246 0.15
247 0.15
248 0.16
249 0.18
250 0.16
251 0.21
252 0.26
253 0.3
254 0.38
255 0.46
256 0.54
257 0.63
258 0.72
259 0.76
260 0.82
261 0.89