Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V2LDB1

Protein Details
Accession A0A1V2LDB1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
165-187LVRGKDFTKGKNKMKRGSYRGGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 16, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006594  LisH  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
GO:0031326  P:regulation of cellular biosynthetic process  
Pfam View protein in Pfam  
PF05022  SRP40_C  
PROSITE View protein in PROSITE  
PS50896  LISH  
Amino Acid Sequences MASQEQILGLVSDYLDRHGLTDVAGKLKKAADKKKLSIADADGKLEDLVKKRARSDSESSSSSSDSDSSSDSDSDSSSEEEKDKKVVKKQKTEASDDSSKTASQASDSRETSIPAGEDDLLPGQRKHFSRIDRSKISFEAAPLTDNTYKGAAGTWGEIANEKLSLVRGKDFTKGKNKMKRGSYRGGSITLASGSYKFQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.11
5 0.12
6 0.12
7 0.1
8 0.16
9 0.16
10 0.22
11 0.24
12 0.23
13 0.24
14 0.27
15 0.32
16 0.36
17 0.43
18 0.46
19 0.54
20 0.58
21 0.64
22 0.64
23 0.6
24 0.55
25 0.5
26 0.49
27 0.42
28 0.39
29 0.3
30 0.26
31 0.25
32 0.23
33 0.21
34 0.16
35 0.23
36 0.27
37 0.29
38 0.32
39 0.38
40 0.41
41 0.44
42 0.47
43 0.47
44 0.46
45 0.45
46 0.43
47 0.39
48 0.35
49 0.29
50 0.23
51 0.16
52 0.11
53 0.11
54 0.1
55 0.1
56 0.11
57 0.1
58 0.1
59 0.1
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.1
66 0.11
67 0.13
68 0.13
69 0.17
70 0.22
71 0.25
72 0.33
73 0.41
74 0.47
75 0.55
76 0.61
77 0.64
78 0.62
79 0.63
80 0.58
81 0.56
82 0.52
83 0.43
84 0.38
85 0.32
86 0.27
87 0.22
88 0.19
89 0.12
90 0.1
91 0.12
92 0.14
93 0.19
94 0.19
95 0.22
96 0.21
97 0.22
98 0.2
99 0.18
100 0.14
101 0.09
102 0.1
103 0.07
104 0.07
105 0.07
106 0.08
107 0.08
108 0.09
109 0.09
110 0.1
111 0.15
112 0.17
113 0.21
114 0.26
115 0.3
116 0.39
117 0.48
118 0.55
119 0.56
120 0.58
121 0.56
122 0.52
123 0.49
124 0.39
125 0.3
126 0.27
127 0.2
128 0.18
129 0.16
130 0.19
131 0.18
132 0.18
133 0.18
134 0.15
135 0.14
136 0.13
137 0.13
138 0.09
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.11
146 0.1
147 0.1
148 0.09
149 0.08
150 0.1
151 0.13
152 0.14
153 0.17
154 0.2
155 0.21
156 0.29
157 0.33
158 0.38
159 0.46
160 0.54
161 0.6
162 0.67
163 0.74
164 0.75
165 0.8
166 0.83
167 0.8
168 0.8
169 0.75
170 0.72
171 0.67
172 0.61
173 0.52
174 0.42
175 0.36
176 0.26
177 0.22
178 0.16
179 0.14