Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2L5K9

Protein Details
Accession A0A1V2L5K9   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
117-138EELKEIPTKRRRLNDKTNTLGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041070  JHD  
Gene Ontology GO:0140680  F:histone H3K36me/H3K36me2 demethylase activity  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF17811  JHD  
Amino Acid Sequences MLKIGNFLTSFNIPEQLKIIDIEIKTKVGKKFKFPNFSKLMWLTAWRVLEGDIEVGETIDAKGCVELLEYLKAQVDRKERGVRQSVPTKYIGNAKSFLKRFEDFVKKNVTVAEVKSEELKEIPTKRRRLNDKTNTLGSDIKTDMTTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.2
4 0.19
5 0.18
6 0.18
7 0.16
8 0.17
9 0.19
10 0.18
11 0.19
12 0.21
13 0.26
14 0.31
15 0.36
16 0.39
17 0.45
18 0.54
19 0.6
20 0.69
21 0.66
22 0.69
23 0.65
24 0.63
25 0.6
26 0.51
27 0.44
28 0.34
29 0.33
30 0.26
31 0.24
32 0.23
33 0.17
34 0.16
35 0.14
36 0.14
37 0.12
38 0.09
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.07
56 0.07
57 0.08
58 0.09
59 0.1
60 0.1
61 0.14
62 0.18
63 0.18
64 0.23
65 0.3
66 0.31
67 0.35
68 0.4
69 0.39
70 0.4
71 0.47
72 0.43
73 0.39
74 0.4
75 0.35
76 0.3
77 0.35
78 0.31
79 0.25
80 0.26
81 0.26
82 0.31
83 0.32
84 0.33
85 0.3
86 0.29
87 0.3
88 0.35
89 0.43
90 0.37
91 0.4
92 0.46
93 0.41
94 0.41
95 0.38
96 0.33
97 0.25
98 0.24
99 0.27
100 0.2
101 0.2
102 0.23
103 0.22
104 0.2
105 0.18
106 0.2
107 0.21
108 0.27
109 0.36
110 0.42
111 0.5
112 0.57
113 0.66
114 0.73
115 0.75
116 0.8
117 0.81
118 0.81
119 0.8
120 0.78
121 0.69
122 0.63
123 0.57
124 0.47
125 0.41
126 0.33
127 0.27