Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061AHY5

Protein Details
Accession A0A061AHY5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-42AQEAPLQKKKTKKSKKLCHHKNCTSQHSIHydrophilic
NLS Segment(s)
PositionSequence
21-29KKKTKKSKK
Subcellular Location(s) nucl 23, cyto_nucl 14.833, mito_nucl 12.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
Amino Acid Sequences MSAETTPAIDVPPAQEAPLQKKKTKKSKKLCHHKNCTSQHSIIGDCSFCQGKFCTRHRLLEAHDCAHYRDVQKDYHERNARQLEAQQTVVSKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.18
4 0.27
5 0.36
6 0.39
7 0.4
8 0.48
9 0.58
10 0.67
11 0.74
12 0.76
13 0.78
14 0.84
15 0.9
16 0.93
17 0.94
18 0.94
19 0.93
20 0.91
21 0.9
22 0.87
23 0.82
24 0.76
25 0.65
26 0.58
27 0.49
28 0.4
29 0.31
30 0.24
31 0.18
32 0.12
33 0.13
34 0.1
35 0.09
36 0.1
37 0.09
38 0.15
39 0.22
40 0.26
41 0.35
42 0.36
43 0.41
44 0.42
45 0.45
46 0.42
47 0.45
48 0.44
49 0.36
50 0.36
51 0.33
52 0.31
53 0.3
54 0.29
55 0.22
56 0.24
57 0.25
58 0.26
59 0.31
60 0.39
61 0.42
62 0.49
63 0.55
64 0.51
65 0.57
66 0.61
67 0.57
68 0.51
69 0.51
70 0.47
71 0.42
72 0.42
73 0.34