Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2LAE3

Protein Details
Accession A0A1V2LAE3    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-52FKPCFRCERKHNAQVTNKLRKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.166, cyto_nucl 10.666, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025261  Atos-like_cons_dom  
Pfam View protein in Pfam  
PF13915  DUF4210  
Amino Acid Sequences MPIPVPTSTPRRRSSLSSDSTHVRVLDYPVFKPCFRCERKHNAQVTNKLRKINKLNNLLGSMQESLLHGMTSGMESKPYKFQAVLSTGVSTTKAIKMSFEAKFYTWQDGSSSPFVGTINLSDEGFVCDKFPGIPVKARSRIQLMICNAEGSLLRHVIMRYNVRKLKDGCKVFIRQSTDDYTMHVNFINVGGSFYIFGDMKVIFHNHVLNEENEGEMKRVVGKPSKVDLSYYLDGCQLCTVIDESDTIHEDLNQMSLEVDSDLSTEATPSDKKQPMVLVGSGTKELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.6
4 0.56
5 0.55
6 0.54
7 0.52
8 0.48
9 0.39
10 0.31
11 0.26
12 0.26
13 0.3
14 0.28
15 0.28
16 0.33
17 0.36
18 0.36
19 0.38
20 0.4
21 0.44
22 0.47
23 0.54
24 0.55
25 0.63
26 0.72
27 0.78
28 0.79
29 0.77
30 0.8
31 0.82
32 0.83
33 0.83
34 0.76
35 0.74
36 0.69
37 0.69
38 0.7
39 0.69
40 0.68
41 0.66
42 0.66
43 0.62
44 0.61
45 0.53
46 0.44
47 0.36
48 0.28
49 0.19
50 0.15
51 0.13
52 0.11
53 0.11
54 0.1
55 0.07
56 0.06
57 0.07
58 0.07
59 0.09
60 0.07
61 0.11
62 0.12
63 0.14
64 0.2
65 0.21
66 0.22
67 0.2
68 0.22
69 0.24
70 0.26
71 0.26
72 0.22
73 0.21
74 0.19
75 0.19
76 0.18
77 0.13
78 0.12
79 0.12
80 0.13
81 0.12
82 0.13
83 0.15
84 0.21
85 0.22
86 0.22
87 0.21
88 0.19
89 0.24
90 0.25
91 0.27
92 0.21
93 0.2
94 0.2
95 0.19
96 0.22
97 0.18
98 0.17
99 0.13
100 0.13
101 0.13
102 0.12
103 0.11
104 0.08
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.1
111 0.1
112 0.09
113 0.07
114 0.07
115 0.07
116 0.07
117 0.09
118 0.1
119 0.1
120 0.15
121 0.19
122 0.25
123 0.31
124 0.32
125 0.32
126 0.32
127 0.34
128 0.31
129 0.32
130 0.27
131 0.25
132 0.24
133 0.22
134 0.18
135 0.15
136 0.14
137 0.1
138 0.1
139 0.07
140 0.07
141 0.08
142 0.09
143 0.11
144 0.14
145 0.2
146 0.22
147 0.3
148 0.33
149 0.33
150 0.39
151 0.4
152 0.44
153 0.46
154 0.45
155 0.4
156 0.42
157 0.44
158 0.42
159 0.43
160 0.41
161 0.33
162 0.34
163 0.35
164 0.33
165 0.29
166 0.27
167 0.26
168 0.21
169 0.2
170 0.18
171 0.13
172 0.1
173 0.11
174 0.1
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.06
183 0.06
184 0.08
185 0.07
186 0.08
187 0.09
188 0.1
189 0.09
190 0.11
191 0.13
192 0.12
193 0.14
194 0.16
195 0.14
196 0.16
197 0.16
198 0.15
199 0.14
200 0.14
201 0.13
202 0.11
203 0.11
204 0.13
205 0.15
206 0.19
207 0.25
208 0.27
209 0.31
210 0.36
211 0.4
212 0.36
213 0.35
214 0.34
215 0.35
216 0.35
217 0.31
218 0.27
219 0.25
220 0.24
221 0.24
222 0.21
223 0.13
224 0.1
225 0.1
226 0.11
227 0.08
228 0.09
229 0.08
230 0.09
231 0.11
232 0.14
233 0.13
234 0.12
235 0.12
236 0.13
237 0.13
238 0.13
239 0.11
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.08
246 0.06
247 0.07
248 0.07
249 0.08
250 0.08
251 0.07
252 0.07
253 0.1
254 0.13
255 0.16
256 0.25
257 0.29
258 0.3
259 0.34
260 0.37
261 0.39
262 0.41
263 0.39
264 0.33
265 0.31
266 0.32