Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2L899

Protein Details
Accession A0A1V2L899   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-97LDEPDSSKGKKKKKKMTYNHLBasic
NLS Segment(s)
PositionSequence
84-91KGKKKKKK
Subcellular Location(s) mito 13, cyto 10.5, cyto_nucl 7, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023582  Impact  
IPR001498  Impact_N  
IPR036956  Impact_N_sf  
IPR020568  Ribosomal_S5_D2-typ_fold  
Pfam View protein in Pfam  
PF01205  UPF0029  
Amino Acid Sequences MYAWRTGPAPKTPTNQGMSDCGEAGAAVRLMGLLERTGLVNVLVVVTRWYGGTPLGGARFRHISTVAVEALKEGGFLDEPDSSKGKKKKKKMTYNHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.43
4 0.41
5 0.38
6 0.34
7 0.28
8 0.21
9 0.17
10 0.14
11 0.13
12 0.1
13 0.06
14 0.05
15 0.05
16 0.04
17 0.05
18 0.05
19 0.05
20 0.03
21 0.04
22 0.04
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.04
41 0.06
42 0.08
43 0.11
44 0.11
45 0.13
46 0.15
47 0.16
48 0.17
49 0.16
50 0.15
51 0.14
52 0.16
53 0.15
54 0.13
55 0.12
56 0.11
57 0.11
58 0.1
59 0.08
60 0.06
61 0.06
62 0.06
63 0.06
64 0.08
65 0.1
66 0.11
67 0.14
68 0.17
69 0.18
70 0.26
71 0.35
72 0.43
73 0.51
74 0.61
75 0.69
76 0.77
77 0.87