Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2L9P1

Protein Details
Accession A0A1V2L9P1   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
35-66NMSMRIVYSKRKKNQKKNQKKQTNDWKPRSRVHydrophilic
112-141DKEKEKANKAKERAKKRKKNNLSNLLSGKKBasic
NLS Segment(s)
PositionSequence
44-56KRKKNQKKNQKKQ
113-133KEKEKANKAKERAKKRKKNNL
Subcellular Location(s) nucl 14.5, mito_nucl 13.333, mito 10, cyto_nucl 9.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MIKTFSKKGLTLPTQISQGTKFCSHCNACLISGFNMSMRIVYSKRKKNQKKNQKKQTNDWKPRSRVLRMTCFSCDGVTDHDVKVPNSPKDVEDYVPKKEKFVAEWKQESPMDKEKEKANKAKERAKKRKKNNLSNLLSGKKEAEAKEKQKSSLLSLDEFLKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.39
4 0.32
5 0.3
6 0.29
7 0.28
8 0.27
9 0.26
10 0.34
11 0.35
12 0.34
13 0.36
14 0.34
15 0.3
16 0.3
17 0.3
18 0.23
19 0.22
20 0.2
21 0.16
22 0.15
23 0.14
24 0.12
25 0.11
26 0.12
27 0.13
28 0.22
29 0.31
30 0.39
31 0.48
32 0.59
33 0.69
34 0.77
35 0.86
36 0.88
37 0.91
38 0.92
39 0.95
40 0.94
41 0.9
42 0.89
43 0.9
44 0.89
45 0.88
46 0.87
47 0.85
48 0.79
49 0.79
50 0.74
51 0.67
52 0.64
53 0.59
54 0.59
55 0.52
56 0.51
57 0.46
58 0.42
59 0.37
60 0.29
61 0.23
62 0.14
63 0.15
64 0.13
65 0.14
66 0.12
67 0.14
68 0.15
69 0.14
70 0.19
71 0.21
72 0.2
73 0.2
74 0.21
75 0.19
76 0.22
77 0.23
78 0.19
79 0.23
80 0.25
81 0.28
82 0.35
83 0.35
84 0.32
85 0.33
86 0.33
87 0.29
88 0.36
89 0.39
90 0.38
91 0.42
92 0.42
93 0.44
94 0.44
95 0.43
96 0.39
97 0.4
98 0.37
99 0.34
100 0.36
101 0.39
102 0.46
103 0.51
104 0.53
105 0.53
106 0.58
107 0.64
108 0.71
109 0.73
110 0.75
111 0.8
112 0.83
113 0.84
114 0.86
115 0.91
116 0.92
117 0.94
118 0.94
119 0.93
120 0.87
121 0.85
122 0.82
123 0.75
124 0.65
125 0.55
126 0.45
127 0.37
128 0.37
129 0.31
130 0.32
131 0.37
132 0.44
133 0.52
134 0.55
135 0.54
136 0.54
137 0.53
138 0.5
139 0.47
140 0.43
141 0.35
142 0.34