FuNGI

A0A1V2L7G4

Protein Details

Accession

A0A1V2L7G4

Localization Confidence

Medium

Confidence Score

14.3

NoLS Segment(s)

Position	Sequence	Protein Nature
81-110	WVLPPRPKAGRKPTNVDKKKQPSSQPQVPA	Hydrophilic
258-287	DPKDIGMMKPRKKKRQYKKKEKQQDAAPPV	Basic

NLS Segment(s)

Position	Sequence
87-93	PKAGRKP
266-279	KPRKKKRQYKKKEK

Subcellular Location(s)

mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 6.833

Family & Domain DBs

InterPro	View protein in InterPro IPR018287 Hap4_TF_heteromerisation
Gene Ontology	GO:0005634 C:nucleus GO:0006355 P:regulation of DNA-templated transcription
Pfam	View protein in Pfam PF10297 Hap4_Hap_bind

Amino Acid Sequences

MNRTVHGVKHTKDLPHLAPIAPAPSIAPRPVQVLPKPSSGIGIASSASTVGAKQLSASSSTTSMTDLESQSLPCIITSKQWVLPPRPKAGRKPTNVDKKKQPSSQPQVPAQQHHEPVVPKRQNSMSSVTSNMNALNITKAQSENLSLAPSSSTITGQFGRDVLKSQLDSATQENEKLKSIISWLKIEIEQLQRLDGNSGGAMATRSNIPSMTMSPDSIDAQTTAAQIHYQLHGTQLNSTQSMSNMSMSSRDASSITVDPKDIGMMKPRKKKRQYKKKEKQQDAAPPVASAKSASNVSKPVESTTHPIKTSVSPVQVKLESSPSPLAIPELNPLNSSGLPTVETIMSTASPEPTHTTSHPSKRCKTVKIERATSIATHDLLSPPTHPLDRTSLSTPGDFGDLHHAPISALSRTTSNTTIDPMDLGWPGKECAFCQGEAGCVCLGKDDKVLNDVKEEESQDLIGLFEDVGGDHLYEEFVNF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.47
3	0.48
4	0.4
5	0.37
6	0.34
7	0.31
8	0.24
9	0.21
10	0.15
11	0.18
12	0.21
13	0.2
14	0.21
15	0.2
16	0.24
17	0.29
18	0.35
19	0.35
20	0.4
21	0.42
22	0.44
23	0.44
24	0.4
25	0.37
26	0.3
27	0.27
28	0.19
29	0.17
30	0.13
31	0.11
32	0.11
33	0.09
34	0.09
35	0.08
36	0.07
37	0.08
38	0.08
39	0.08
40	0.09
41	0.11
42	0.12
43	0.14
44	0.15
45	0.15
46	0.15
47	0.16
48	0.16
49	0.15
50	0.14
51	0.13
52	0.16
53	0.15
54	0.16
55	0.17
56	0.17
57	0.16
58	0.17
59	0.15
60	0.12
61	0.13
62	0.11
63	0.14
64	0.19
65	0.23
66	0.25
67	0.3
68	0.36
69	0.43
70	0.51
71	0.53
72	0.57
73	0.62
74	0.65
75	0.7
76	0.75
77	0.76
78	0.74
79	0.77
80	0.78
81	0.8
82	0.82
83	0.8
84	0.79
85	0.8
86	0.81
87	0.8
88	0.78
89	0.78
90	0.8
91	0.81
92	0.77
93	0.73
94	0.73
95	0.7
96	0.66
97	0.61
98	0.58
99	0.51
100	0.46
101	0.44
102	0.39
103	0.41
104	0.46
105	0.45
106	0.39
107	0.42
108	0.44
109	0.43
110	0.43
111	0.43
112	0.36
113	0.33
114	0.35
115	0.31
116	0.27
117	0.25
118	0.21
119	0.16
120	0.13
121	0.11
122	0.1
123	0.1
124	0.11
125	0.11
126	0.12
127	0.12
128	0.12
129	0.13
130	0.13
131	0.13
132	0.12
133	0.1
134	0.1
135	0.1
136	0.09
137	0.09
138	0.08
139	0.08
140	0.07
141	0.1
142	0.11
143	0.12
144	0.12
145	0.12
146	0.13
147	0.13
148	0.15
149	0.14
150	0.15
151	0.15
152	0.15
153	0.16
154	0.15
155	0.16
156	0.16
157	0.18
158	0.16
159	0.19
160	0.2
161	0.19
162	0.2
163	0.18
164	0.17
165	0.13
166	0.16
167	0.18
168	0.18
169	0.18
170	0.18
171	0.19
172	0.19
173	0.2
174	0.21
175	0.2
176	0.2
177	0.19
178	0.19
179	0.17
180	0.17
181	0.17
182	0.12
183	0.09
184	0.06
185	0.06
186	0.05
187	0.05
188	0.05
189	0.04
190	0.05
191	0.05
192	0.06
193	0.06
194	0.06
195	0.07
196	0.07
197	0.08
198	0.12
199	0.12
200	0.12
201	0.12
202	0.13
203	0.13
204	0.12
205	0.11
206	0.08
207	0.07
208	0.08
209	0.08
210	0.07
211	0.06
212	0.06
213	0.06
214	0.07
215	0.08
216	0.07
217	0.07
218	0.09
219	0.11
220	0.11
221	0.12
222	0.13
223	0.14
224	0.13
225	0.14
226	0.12
227	0.1
228	0.12
229	0.11
230	0.1
231	0.09
232	0.09
233	0.09
234	0.09
235	0.1
236	0.08
237	0.08
238	0.08
239	0.08
240	0.1
241	0.11
242	0.12
243	0.11
244	0.11
245	0.11
246	0.11
247	0.11
248	0.1
249	0.09
250	0.16
251	0.24
252	0.32
253	0.41
254	0.5
255	0.59
256	0.69
257	0.79
258	0.81
259	0.84
260	0.88
261	0.91
262	0.93
263	0.94
264	0.95
265	0.92
266	0.88
267	0.85
268	0.83
269	0.76
270	0.69
271	0.58
272	0.47
273	0.4
274	0.32
275	0.24
276	0.15
277	0.11
278	0.09
279	0.11
280	0.12
281	0.13
282	0.16
283	0.17
284	0.18
285	0.18
286	0.18
287	0.17
288	0.18
289	0.22
290	0.25
291	0.28
292	0.27
293	0.27
294	0.27
295	0.27
296	0.3
297	0.29
298	0.29
299	0.27
300	0.27
301	0.31
302	0.3
303	0.29
304	0.25
305	0.25
306	0.2
307	0.21
308	0.2
309	0.17
310	0.16
311	0.15
312	0.15
313	0.12
314	0.12
315	0.12
316	0.14
317	0.14
318	0.14
319	0.15
320	0.16
321	0.15
322	0.15
323	0.13
324	0.1
325	0.1
326	0.1
327	0.11
328	0.09
329	0.09
330	0.08
331	0.08
332	0.07
333	0.08
334	0.08
335	0.08
336	0.08
337	0.1
338	0.14
339	0.15
340	0.18
341	0.18
342	0.25
343	0.32
344	0.42
345	0.49
346	0.53
347	0.57
348	0.64
349	0.7
350	0.69
351	0.71
352	0.72
353	0.73
354	0.74
355	0.74
356	0.66
357	0.62
358	0.57
359	0.47
360	0.39
361	0.32
362	0.24
363	0.19
364	0.17
365	0.16
366	0.16
367	0.16
368	0.14
369	0.15
370	0.17
371	0.17
372	0.17
373	0.19
374	0.23
375	0.25
376	0.28
377	0.29
378	0.31
379	0.31
380	0.31
381	0.28
382	0.23
383	0.21
384	0.17
385	0.15
386	0.19
387	0.18
388	0.19
389	0.19
390	0.18
391	0.16
392	0.19
393	0.2
394	0.13
395	0.14
396	0.13
397	0.14
398	0.16
399	0.2
400	0.2
401	0.19
402	0.19
403	0.21
404	0.21
405	0.2
406	0.19
407	0.15
408	0.15
409	0.15
410	0.15
411	0.13
412	0.13
413	0.14
414	0.16
415	0.17
416	0.15
417	0.21
418	0.22
419	0.21
420	0.22
421	0.22
422	0.24
423	0.23
424	0.24
425	0.17
426	0.15
427	0.15
428	0.17
429	0.18
430	0.15
431	0.19
432	0.2
433	0.21
434	0.27
435	0.31
436	0.27
437	0.3
438	0.3
439	0.29
440	0.3
441	0.31
442	0.27
443	0.24
444	0.23
445	0.2
446	0.18
447	0.15
448	0.11
449	0.09
450	0.07
451	0.06
452	0.06
453	0.05
454	0.07
455	0.07
456	0.07
457	0.07
458	0.07
459	0.08

A0A1V2L7G4

3D AlphaFold-predicted Structure Viewer