Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2L7G4

Protein Details
Accession A0A1V2L7G4   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-110WVLPPRPKAGRKPTNVDKKKQPSSQPQVPAHydrophilic
258-287DPKDIGMMKPRKKKRQYKKKEKQQDAAPPVBasic
NLS Segment(s)
PositionSequence
87-93PKAGRKP
266-279KPRKKKRQYKKKEK
Subcellular Location(s) mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR018287  Hap4_TF_heteromerisation  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF10297  Hap4_Hap_bind  
Amino Acid Sequences MNRTVHGVKHTKDLPHLAPIAPAPSIAPRPVQVLPKPSSGIGIASSASTVGAKQLSASSSTTSMTDLESQSLPCIITSKQWVLPPRPKAGRKPTNVDKKKQPSSQPQVPAQQHHEPVVPKRQNSMSSVTSNMNALNITKAQSENLSLAPSSSTITGQFGRDVLKSQLDSATQENEKLKSIISWLKIEIEQLQRLDGNSGGAMATRSNIPSMTMSPDSIDAQTTAAQIHYQLHGTQLNSTQSMSNMSMSSRDASSITVDPKDIGMMKPRKKKRQYKKKEKQQDAAPPVASAKSASNVSKPVESTTHPIKTSVSPVQVKLESSPSPLAIPELNPLNSSGLPTVETIMSTASPEPTHTTSHPSKRCKTVKIERATSIATHDLLSPPTHPLDRTSLSTPGDFGDLHHAPISALSRTTSNTTIDPMDLGWPGKECAFCQGEAGCVCLGKDDKVLNDVKEEESQDLIGLFEDVGGDHLYEEFVNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.48
4 0.4
5 0.37
6 0.34
7 0.31
8 0.24
9 0.21
10 0.15
11 0.18
12 0.21
13 0.2
14 0.21
15 0.2
16 0.24
17 0.29
18 0.35
19 0.35
20 0.4
21 0.42
22 0.44
23 0.44
24 0.4
25 0.37
26 0.3
27 0.27
28 0.19
29 0.17
30 0.13
31 0.11
32 0.11
33 0.09
34 0.09
35 0.08
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.11
42 0.12
43 0.14
44 0.15
45 0.15
46 0.15
47 0.16
48 0.16
49 0.15
50 0.14
51 0.13
52 0.16
53 0.15
54 0.16
55 0.17
56 0.17
57 0.16
58 0.17
59 0.15
60 0.12
61 0.13
62 0.11
63 0.14
64 0.19
65 0.23
66 0.25
67 0.3
68 0.36
69 0.43
70 0.51
71 0.53
72 0.57
73 0.62
74 0.65
75 0.7
76 0.75
77 0.76
78 0.74
79 0.77
80 0.78
81 0.8
82 0.82
83 0.8
84 0.79
85 0.8
86 0.81
87 0.8
88 0.78
89 0.78
90 0.8
91 0.81
92 0.77
93 0.73
94 0.73
95 0.7
96 0.66
97 0.61
98 0.58
99 0.51
100 0.46
101 0.44
102 0.39
103 0.41
104 0.46
105 0.45
106 0.39
107 0.42
108 0.44
109 0.43
110 0.43
111 0.43
112 0.36
113 0.33
114 0.35
115 0.31
116 0.27
117 0.25
118 0.21
119 0.16
120 0.13
121 0.11
122 0.1
123 0.1
124 0.11
125 0.11
126 0.12
127 0.12
128 0.12
129 0.13
130 0.13
131 0.13
132 0.12
133 0.1
134 0.1
135 0.1
136 0.09
137 0.09
138 0.08
139 0.08
140 0.07
141 0.1
142 0.11
143 0.12
144 0.12
145 0.12
146 0.13
147 0.13
148 0.15
149 0.14
150 0.15
151 0.15
152 0.15
153 0.16
154 0.15
155 0.16
156 0.16
157 0.18
158 0.16
159 0.19
160 0.2
161 0.19
162 0.2
163 0.18
164 0.17
165 0.13
166 0.16
167 0.18
168 0.18
169 0.18
170 0.18
171 0.19
172 0.19
173 0.2
174 0.21
175 0.2
176 0.2
177 0.19
178 0.19
179 0.17
180 0.17
181 0.17
182 0.12
183 0.09
184 0.06
185 0.06
186 0.05
187 0.05
188 0.05
189 0.04
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.07
196 0.07
197 0.08
198 0.12
199 0.12
200 0.12
201 0.12
202 0.13
203 0.13
204 0.12
205 0.11
206 0.08
207 0.07
208 0.08
209 0.08
210 0.07
211 0.06
212 0.06
213 0.06
214 0.07
215 0.08
216 0.07
217 0.07
218 0.09
219 0.11
220 0.11
221 0.12
222 0.13
223 0.14
224 0.13
225 0.14
226 0.12
227 0.1
228 0.12
229 0.11
230 0.1
231 0.09
232 0.09
233 0.09
234 0.09
235 0.1
236 0.08
237 0.08
238 0.08
239 0.08
240 0.1
241 0.11
242 0.12
243 0.11
244 0.11
245 0.11
246 0.11
247 0.11
248 0.1
249 0.09
250 0.16
251 0.24
252 0.32
253 0.41
254 0.5
255 0.59
256 0.69
257 0.79
258 0.81
259 0.84
260 0.88
261 0.91
262 0.93
263 0.94
264 0.95
265 0.92
266 0.88
267 0.85
268 0.83
269 0.76
270 0.69
271 0.58
272 0.47
273 0.4
274 0.32
275 0.24
276 0.15
277 0.11
278 0.09
279 0.11
280 0.12
281 0.13
282 0.16
283 0.17
284 0.18
285 0.18
286 0.18
287 0.17
288 0.18
289 0.22
290 0.25
291 0.28
292 0.27
293 0.27
294 0.27
295 0.27
296 0.3
297 0.29
298 0.29
299 0.27
300 0.27
301 0.31
302 0.3
303 0.29
304 0.25
305 0.25
306 0.2
307 0.21
308 0.2
309 0.17
310 0.16
311 0.15
312 0.15
313 0.12
314 0.12
315 0.12
316 0.14
317 0.14
318 0.14
319 0.15
320 0.16
321 0.15
322 0.15
323 0.13
324 0.1
325 0.1
326 0.1
327 0.11
328 0.09
329 0.09
330 0.08
331 0.08
332 0.07
333 0.08
334 0.08
335 0.08
336 0.08
337 0.1
338 0.14
339 0.15
340 0.18
341 0.18
342 0.25
343 0.32
344 0.42
345 0.49
346 0.53
347 0.57
348 0.64
349 0.7
350 0.69
351 0.71
352 0.72
353 0.73
354 0.74
355 0.74
356 0.66
357 0.62
358 0.57
359 0.47
360 0.39
361 0.32
362 0.24
363 0.19
364 0.17
365 0.16
366 0.16
367 0.16
368 0.14
369 0.15
370 0.17
371 0.17
372 0.17
373 0.19
374 0.23
375 0.25
376 0.28
377 0.29
378 0.31
379 0.31
380 0.31
381 0.28
382 0.23
383 0.21
384 0.17
385 0.15
386 0.19
387 0.18
388 0.19
389 0.19
390 0.18
391 0.16
392 0.19
393 0.2
394 0.13
395 0.14
396 0.13
397 0.14
398 0.16
399 0.2
400 0.2
401 0.19
402 0.19
403 0.21
404 0.21
405 0.2
406 0.19
407 0.15
408 0.15
409 0.15
410 0.15
411 0.13
412 0.13
413 0.14
414 0.16
415 0.17
416 0.15
417 0.21
418 0.22
419 0.21
420 0.22
421 0.22
422 0.24
423 0.23
424 0.24
425 0.17
426 0.15
427 0.15
428 0.17
429 0.18
430 0.15
431 0.19
432 0.2
433 0.21
434 0.27
435 0.31
436 0.27
437 0.3
438 0.3
439 0.29
440 0.3
441 0.31
442 0.27
443 0.24
444 0.23
445 0.2
446 0.18
447 0.15
448 0.11
449 0.09
450 0.07
451 0.06
452 0.06
453 0.05
454 0.07
455 0.07
456 0.07
457 0.07
458 0.07
459 0.08