Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2KYP7

Protein Details
Accession A0A1V2KYP7   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSHQKYRHRKRLQSVDRVIASHydrophilic
65-91FEKGYRKSVHRTPKWTKKTQRVNPEYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MSSHQKYRHRKRLQSVDRVIASVFDGLKGKTEYQSDAKHLIAKYAKLPTEAEMKPLDKYTVFDRFEKGYRKSVHRTPKWTKKTQRVNPEYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.84
3 0.8
4 0.71
5 0.63
6 0.52
7 0.41
8 0.32
9 0.23
10 0.17
11 0.1
12 0.11
13 0.1
14 0.13
15 0.14
16 0.14
17 0.14
18 0.16
19 0.18
20 0.22
21 0.24
22 0.24
23 0.25
24 0.24
25 0.26
26 0.25
27 0.26
28 0.22
29 0.21
30 0.21
31 0.22
32 0.22
33 0.19
34 0.2
35 0.17
36 0.23
37 0.22
38 0.21
39 0.2
40 0.2
41 0.2
42 0.21
43 0.2
44 0.13
45 0.15
46 0.17
47 0.23
48 0.24
49 0.25
50 0.26
51 0.29
52 0.34
53 0.39
54 0.38
55 0.38
56 0.42
57 0.48
58 0.52
59 0.58
60 0.63
61 0.64
62 0.71
63 0.73
64 0.79
65 0.81
66 0.84
67 0.86
68 0.86
69 0.89
70 0.89
71 0.89