Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061AKP5

Protein Details
Accession A0A061AKP5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
54-81DEKYQKALFRPKKKNTQQQQQQQPKPKEHydrophilic
86-110VETPKEEPKKSKKEDKSKVTKPSLKBasic
NLS Segment(s)
PositionSequence
77-134PKPKEQPKKVETPKEEPKKSKKEDKSKVTKPSLKEHKGKDLYKALKKFSKDEKKELLK
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039999  LYAR  
IPR014898  Znf_C2H2_LYAR  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08790  zf-LYAR  
PROSITE View protein in PROSITE  
PS51804  ZF_C2HC_LYAR  
Amino Acid Sequences MVTFSCEVCNESLAKKKLDQHTQRCYGAYFTCIDCSTTFNGNDYRQHTQCITEDEKYQKALFRPKKKNTQQQQQQQPKPKEQPKKVETPKEEPKKSKKEDKSKVTKPSLKEHKGKDLYKALKKFSKDEKKELLKRISIKDDGSLVLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.41
4 0.48
5 0.57
6 0.63
7 0.64
8 0.7
9 0.74
10 0.71
11 0.64
12 0.56
13 0.49
14 0.4
15 0.32
16 0.24
17 0.18
18 0.19
19 0.18
20 0.19
21 0.16
22 0.17
23 0.18
24 0.2
25 0.19
26 0.18
27 0.22
28 0.23
29 0.28
30 0.3
31 0.34
32 0.3
33 0.32
34 0.31
35 0.29
36 0.29
37 0.29
38 0.28
39 0.23
40 0.27
41 0.28
42 0.29
43 0.28
44 0.27
45 0.24
46 0.25
47 0.33
48 0.38
49 0.45
50 0.54
51 0.6
52 0.7
53 0.76
54 0.83
55 0.82
56 0.83
57 0.82
58 0.82
59 0.85
60 0.84
61 0.82
62 0.81
63 0.76
64 0.72
65 0.72
66 0.71
67 0.7
68 0.68
69 0.71
70 0.65
71 0.72
72 0.73
73 0.72
74 0.69
75 0.67
76 0.71
77 0.7
78 0.72
79 0.7
80 0.72
81 0.73
82 0.74
83 0.77
84 0.76
85 0.77
86 0.81
87 0.83
88 0.84
89 0.82
90 0.85
91 0.84
92 0.79
93 0.72
94 0.73
95 0.73
96 0.71
97 0.7
98 0.65
99 0.67
100 0.7
101 0.67
102 0.64
103 0.63
104 0.64
105 0.65
106 0.66
107 0.62
108 0.59
109 0.61
110 0.6
111 0.62
112 0.64
113 0.62
114 0.65
115 0.68
116 0.73
117 0.78
118 0.8
119 0.76
120 0.72
121 0.73
122 0.72
123 0.68
124 0.61
125 0.55
126 0.49
127 0.43