Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V2KYU3

Protein Details
Accession A0A1V2KYU3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
187-206SSNYYRWKGKLKLKMKRVIWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024253  Phosducin_thioredoxin-like_dom  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF02114  Phosducin  
CDD cd02989  Phd_like_TxnDC9  
Amino Acid Sequences MTDKILDDYQQRLVRNQLGYNSESDPEDDEILELLDDDFNNNYREQRIQQLSDQFKQSKKQISQEGHGSVETILSEEQILKITTSTTLTVIHFYHDTFDKCKKMNDKLETLAQKHLSTKFIRVNVDNAPFLVTRLNIKVLPCVVMYIKGVEAGRIVGFDHLDYDAKRDDFTIESLEKVYVIRRLRESSNYYRWKGKLKLKMKRVIWIYNIIILIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.4
4 0.37
5 0.36
6 0.36
7 0.37
8 0.33
9 0.28
10 0.25
11 0.23
12 0.21
13 0.18
14 0.17
15 0.15
16 0.13
17 0.11
18 0.11
19 0.1
20 0.07
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.1
27 0.11
28 0.12
29 0.13
30 0.15
31 0.19
32 0.2
33 0.28
34 0.31
35 0.33
36 0.37
37 0.44
38 0.48
39 0.48
40 0.52
41 0.46
42 0.44
43 0.47
44 0.48
45 0.49
46 0.47
47 0.5
48 0.53
49 0.53
50 0.54
51 0.54
52 0.5
53 0.42
54 0.38
55 0.31
56 0.22
57 0.18
58 0.14
59 0.09
60 0.06
61 0.05
62 0.06
63 0.05
64 0.05
65 0.07
66 0.07
67 0.06
68 0.06
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.11
77 0.11
78 0.12
79 0.11
80 0.1
81 0.11
82 0.13
83 0.14
84 0.15
85 0.19
86 0.21
87 0.22
88 0.26
89 0.3
90 0.35
91 0.43
92 0.43
93 0.42
94 0.41
95 0.46
96 0.45
97 0.41
98 0.37
99 0.3
100 0.26
101 0.26
102 0.25
103 0.23
104 0.21
105 0.24
106 0.25
107 0.27
108 0.28
109 0.26
110 0.28
111 0.28
112 0.3
113 0.25
114 0.2
115 0.19
116 0.17
117 0.16
118 0.14
119 0.1
120 0.1
121 0.11
122 0.13
123 0.12
124 0.13
125 0.15
126 0.14
127 0.15
128 0.13
129 0.13
130 0.11
131 0.11
132 0.11
133 0.1
134 0.1
135 0.11
136 0.11
137 0.1
138 0.1
139 0.09
140 0.09
141 0.08
142 0.08
143 0.06
144 0.07
145 0.06
146 0.07
147 0.08
148 0.09
149 0.09
150 0.12
151 0.15
152 0.15
153 0.15
154 0.14
155 0.15
156 0.15
157 0.16
158 0.18
159 0.15
160 0.16
161 0.17
162 0.16
163 0.15
164 0.14
165 0.15
166 0.17
167 0.2
168 0.24
169 0.27
170 0.31
171 0.35
172 0.41
173 0.47
174 0.49
175 0.56
176 0.59
177 0.59
178 0.62
179 0.62
180 0.64
181 0.65
182 0.65
183 0.66
184 0.68
185 0.74
186 0.76
187 0.82
188 0.76
189 0.76
190 0.73
191 0.7
192 0.63
193 0.6
194 0.52
195 0.47