Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A9CTA9

Protein Details
Accession A9CTA9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-27VAAPLKRDRLPKKPRMDITRGHydrophilic
NLS Segment(s)
PositionSequence
75-83KGKPELRKK
92-97QKKIWK
Subcellular Location(s) cyto 10, mito 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036853  Ribosomal_L14_sf  
IPR000218  Ribosomal_L14P  
IPR019972  Ribosomal_L14P_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00238  Ribosomal_L14  
PROSITE View protein in PROSITE  
PS00049  RIBOSOMAL_L14  
Amino Acid Sequences MAKEVKVAAPLKRDRLPKKPRMDITRGVQTETRLRVVDNSGAKEVKIIGVKNLQCRLNTIPKAAPGDVVVVSVKKGKPELRKKVVLAIVVRQKKIWKRKDGVNICFEDNACVLVDQKGELKGTQISGPIPREVAELWPKIASQASSID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.71
4 0.72
5 0.76
6 0.79
7 0.82
8 0.81
9 0.8
10 0.77
11 0.73
12 0.74
13 0.65
14 0.58
15 0.5
16 0.45
17 0.45
18 0.39
19 0.35
20 0.25
21 0.25
22 0.24
23 0.25
24 0.28
25 0.25
26 0.25
27 0.25
28 0.25
29 0.24
30 0.23
31 0.2
32 0.17
33 0.17
34 0.14
35 0.14
36 0.21
37 0.23
38 0.28
39 0.33
40 0.32
41 0.29
42 0.32
43 0.34
44 0.37
45 0.36
46 0.33
47 0.29
48 0.3
49 0.32
50 0.29
51 0.24
52 0.15
53 0.15
54 0.12
55 0.12
56 0.09
57 0.07
58 0.07
59 0.1
60 0.1
61 0.1
62 0.12
63 0.17
64 0.27
65 0.38
66 0.47
67 0.5
68 0.54
69 0.54
70 0.57
71 0.54
72 0.47
73 0.38
74 0.34
75 0.36
76 0.36
77 0.35
78 0.3
79 0.34
80 0.39
81 0.48
82 0.51
83 0.51
84 0.53
85 0.61
86 0.7
87 0.74
88 0.71
89 0.68
90 0.61
91 0.53
92 0.49
93 0.41
94 0.32
95 0.23
96 0.18
97 0.12
98 0.1
99 0.09
100 0.09
101 0.1
102 0.09
103 0.11
104 0.12
105 0.12
106 0.12
107 0.14
108 0.14
109 0.15
110 0.16
111 0.15
112 0.16
113 0.2
114 0.23
115 0.22
116 0.21
117 0.19
118 0.2
119 0.19
120 0.23
121 0.25
122 0.24
123 0.25
124 0.25
125 0.25
126 0.25
127 0.26
128 0.2