Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2LD36

Protein Details
Accession A0A1V2LD36   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-47MDWFSMKKDQQKKKEKAEDTSKVHydrophilic
197-223VKMNVTTKERKSKYKKLLKEAKAAQEAHydrophilic
NLS Segment(s)
PositionSequence
206-215RKSKYKKLLK
Subcellular Location(s) mito 13, nucl 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036736  ACP-like_sf  
IPR018305  Ribosomal_L50_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF10501  Ribosomal_L50  
Amino Acid Sequences MITTRATTQISRRLLHTSSVQYGFMDWFSMKKDQQKKKEKAEDTSKVIERAEKGEVQVTKVEKIEFIGKKKDPADLRPISERLQGFSIKPWLSKSKVTTADEFKNIILSNYTKFTKKTTDDLSQVDLKNLNLRFDITKAVQAESGYLIPDYVLTKANDGSVLQQYFEQKILTGDYLITNPEHLDIEDFEYSSPNISVKMNVTTKERKSKYKKLLKEAKAAQEAKAAELMKGVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.4
4 0.37
5 0.37
6 0.38
7 0.36
8 0.3
9 0.3
10 0.27
11 0.21
12 0.18
13 0.11
14 0.11
15 0.14
16 0.19
17 0.22
18 0.3
19 0.4
20 0.49
21 0.59
22 0.69
23 0.74
24 0.8
25 0.87
26 0.83
27 0.82
28 0.82
29 0.79
30 0.74
31 0.73
32 0.64
33 0.56
34 0.51
35 0.45
36 0.36
37 0.31
38 0.29
39 0.22
40 0.21
41 0.25
42 0.25
43 0.23
44 0.25
45 0.24
46 0.23
47 0.23
48 0.22
49 0.17
50 0.18
51 0.25
52 0.25
53 0.28
54 0.33
55 0.33
56 0.39
57 0.39
58 0.44
59 0.38
60 0.38
61 0.43
62 0.39
63 0.41
64 0.4
65 0.41
66 0.37
67 0.39
68 0.34
69 0.27
70 0.26
71 0.24
72 0.19
73 0.2
74 0.24
75 0.2
76 0.2
77 0.22
78 0.24
79 0.26
80 0.29
81 0.3
82 0.31
83 0.37
84 0.39
85 0.39
86 0.4
87 0.4
88 0.38
89 0.36
90 0.28
91 0.23
92 0.21
93 0.17
94 0.13
95 0.11
96 0.11
97 0.13
98 0.15
99 0.14
100 0.15
101 0.17
102 0.21
103 0.22
104 0.25
105 0.27
106 0.3
107 0.32
108 0.32
109 0.33
110 0.32
111 0.3
112 0.26
113 0.22
114 0.18
115 0.2
116 0.2
117 0.18
118 0.13
119 0.14
120 0.14
121 0.14
122 0.17
123 0.12
124 0.15
125 0.15
126 0.15
127 0.15
128 0.14
129 0.14
130 0.12
131 0.11
132 0.08
133 0.07
134 0.07
135 0.05
136 0.06
137 0.06
138 0.06
139 0.09
140 0.09
141 0.1
142 0.11
143 0.11
144 0.11
145 0.1
146 0.12
147 0.14
148 0.14
149 0.14
150 0.15
151 0.17
152 0.17
153 0.18
154 0.15
155 0.11
156 0.11
157 0.13
158 0.11
159 0.1
160 0.09
161 0.09
162 0.1
163 0.1
164 0.1
165 0.08
166 0.08
167 0.09
168 0.09
169 0.08
170 0.09
171 0.09
172 0.13
173 0.13
174 0.13
175 0.12
176 0.13
177 0.13
178 0.13
179 0.12
180 0.09
181 0.1
182 0.1
183 0.12
184 0.13
185 0.21
186 0.22
187 0.24
188 0.31
189 0.38
190 0.45
191 0.54
192 0.56
193 0.6
194 0.66
195 0.74
196 0.79
197 0.81
198 0.82
199 0.82
200 0.88
201 0.84
202 0.85
203 0.82
204 0.8
205 0.79
206 0.71
207 0.62
208 0.57
209 0.51
210 0.42
211 0.39
212 0.3
213 0.21
214 0.21