Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V2L9T6

Protein Details
Accession A0A1V2L9T6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
140-162IGPKLSTRQPPKVPKKPVNLSGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001715  CH_dom  
IPR036872  CH_dom_sf  
IPR003096  SM22_calponin  
Gene Ontology GO:0016043  P:cellular component organization  
Pfam View protein in Pfam  
PF00307  CH  
PROSITE View protein in PROSITE  
PS50021  CH  
Amino Acid Sequences MEDPYQKKADVSSLDADLRELRRGKYNKELASQAKSWIFNVIEESEPQGELIETIKNGVALGKLSNKLGGNVKWKESKFPFVQMENIAGFITFVKSYGIPEDETFQTIDLYEEGDITSVLQTIISLSRYVHEKNPSIPVIGPKLSTRQPPKVPKKPVNLSGGWSSLEYGYMKGASQSSEGVVFGKNRDITGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.28
4 0.26
5 0.25
6 0.27
7 0.27
8 0.26
9 0.34
10 0.38
11 0.43
12 0.48
13 0.55
14 0.53
15 0.55
16 0.6
17 0.55
18 0.57
19 0.52
20 0.47
21 0.43
22 0.39
23 0.34
24 0.32
25 0.28
26 0.22
27 0.24
28 0.21
29 0.18
30 0.17
31 0.19
32 0.15
33 0.14
34 0.14
35 0.11
36 0.09
37 0.08
38 0.09
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.08
49 0.11
50 0.12
51 0.12
52 0.15
53 0.15
54 0.17
55 0.2
56 0.22
57 0.26
58 0.27
59 0.31
60 0.34
61 0.34
62 0.39
63 0.38
64 0.41
65 0.34
66 0.38
67 0.38
68 0.33
69 0.35
70 0.28
71 0.28
72 0.21
73 0.2
74 0.13
75 0.1
76 0.09
77 0.06
78 0.07
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.07
85 0.08
86 0.07
87 0.08
88 0.11
89 0.1
90 0.11
91 0.11
92 0.1
93 0.09
94 0.08
95 0.08
96 0.05
97 0.06
98 0.05
99 0.05
100 0.04
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.03
108 0.03
109 0.04
110 0.05
111 0.06
112 0.06
113 0.06
114 0.08
115 0.11
116 0.13
117 0.18
118 0.22
119 0.23
120 0.26
121 0.31
122 0.3
123 0.29
124 0.28
125 0.27
126 0.26
127 0.25
128 0.24
129 0.2
130 0.24
131 0.26
132 0.33
133 0.36
134 0.41
135 0.49
136 0.59
137 0.68
138 0.73
139 0.8
140 0.8
141 0.83
142 0.83
143 0.81
144 0.77
145 0.67
146 0.61
147 0.54
148 0.48
149 0.38
150 0.3
151 0.23
152 0.17
153 0.18
154 0.14
155 0.11
156 0.11
157 0.11
158 0.11
159 0.11
160 0.12
161 0.12
162 0.12
163 0.13
164 0.12
165 0.13
166 0.13
167 0.12
168 0.14
169 0.15
170 0.15
171 0.21
172 0.21