Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2LCV3

Protein Details
Accession A0A1V2LCV3   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-32ASLPHPKIVKKVTKKFKRHHSDRYARVSENHydrophilic
NLS Segment(s)
PositionSequence
11-22VKKVTKKFKRHH
Subcellular Location(s) mito 17, cyto 7, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKVTKKFKRHHSDRYARVSENWRKQKGIDSCVRRRFRGTIPQPKIGFRTNKKTRHMMPSGHKAFLVQNVKDLDLLLLHTKTYAAEIGHGVSSKNRVEILARAKALGLKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.76
3 0.85
4 0.87
5 0.89
6 0.9
7 0.88
8 0.89
9 0.89
10 0.88
11 0.87
12 0.87
13 0.81
14 0.71
15 0.67
16 0.66
17 0.65
18 0.65
19 0.66
20 0.59
21 0.56
22 0.55
23 0.59
24 0.55
25 0.53
26 0.51
27 0.51
28 0.57
29 0.66
30 0.68
31 0.61
32 0.58
33 0.55
34 0.52
35 0.54
36 0.54
37 0.55
38 0.57
39 0.63
40 0.61
41 0.58
42 0.55
43 0.5
44 0.48
45 0.43
46 0.48
47 0.5
48 0.56
49 0.59
50 0.61
51 0.6
52 0.59
53 0.58
54 0.54
55 0.51
56 0.54
57 0.52
58 0.47
59 0.42
60 0.35
61 0.32
62 0.33
63 0.32
64 0.21
65 0.23
66 0.23
67 0.24
68 0.23
69 0.22
70 0.15
71 0.09
72 0.11
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.07
82 0.08
83 0.08
84 0.1
85 0.1
86 0.11
87 0.1
88 0.1
89 0.14
90 0.14
91 0.15
92 0.14
93 0.14
94 0.16
95 0.22
96 0.27
97 0.29
98 0.29
99 0.28
100 0.28
101 0.3
102 0.29
103 0.27
104 0.21
105 0.2
106 0.29
107 0.37
108 0.42
109 0.41
110 0.43
111 0.42