Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2L8K2

Protein Details
Accession A0A1V2L8K2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
228-248VTSGPKVRKGRVKPVGHKFLLHydrophilic
NLS Segment(s)
PositionSequence
232-252PKVRKGRVKPVGHKFLLKKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014804  Pet20-like  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF08692  Pet20  
Amino Acid Sequences MTSSRGLPPWPATIREVDENESWELKGGKSDTTRVATRAQSTKTTTSNSSKAVKSAVAAKVSQKGEYNTFSSNQNINQQEKRDSASTSGSASPSSQKPTPERKVKKDYSALPKVPSTSHLNPQKIIIDSFYAGYRPLAMQGLKQNLLPSKKKTLFDLGLEDEPVWAYSASGLDVFPEWDHVPMKQLKNLTPFKPPMTEEQKAKKAAEEMKMNLKEASQEQGKKEIQSVTSGPKVRKGRVKPVGHKFLLKKKKYVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.39
4 0.35
5 0.33
6 0.33
7 0.33
8 0.3
9 0.26
10 0.22
11 0.21
12 0.17
13 0.2
14 0.19
15 0.21
16 0.23
17 0.27
18 0.29
19 0.33
20 0.35
21 0.32
22 0.36
23 0.34
24 0.38
25 0.41
26 0.39
27 0.39
28 0.41
29 0.44
30 0.43
31 0.43
32 0.42
33 0.42
34 0.43
35 0.43
36 0.43
37 0.39
38 0.37
39 0.35
40 0.3
41 0.25
42 0.28
43 0.27
44 0.24
45 0.24
46 0.25
47 0.31
48 0.31
49 0.32
50 0.27
51 0.26
52 0.27
53 0.29
54 0.29
55 0.24
56 0.24
57 0.24
58 0.25
59 0.25
60 0.24
61 0.28
62 0.3
63 0.33
64 0.36
65 0.37
66 0.37
67 0.36
68 0.37
69 0.31
70 0.27
71 0.25
72 0.23
73 0.21
74 0.19
75 0.19
76 0.16
77 0.15
78 0.15
79 0.17
80 0.16
81 0.2
82 0.2
83 0.23
84 0.29
85 0.39
86 0.47
87 0.54
88 0.59
89 0.63
90 0.71
91 0.71
92 0.7
93 0.67
94 0.66
95 0.65
96 0.65
97 0.59
98 0.51
99 0.48
100 0.42
101 0.36
102 0.32
103 0.3
104 0.25
105 0.31
106 0.36
107 0.36
108 0.36
109 0.36
110 0.35
111 0.28
112 0.26
113 0.18
114 0.11
115 0.11
116 0.11
117 0.1
118 0.07
119 0.07
120 0.06
121 0.06
122 0.05
123 0.06
124 0.07
125 0.07
126 0.09
127 0.13
128 0.16
129 0.16
130 0.17
131 0.18
132 0.21
133 0.26
134 0.28
135 0.28
136 0.34
137 0.39
138 0.39
139 0.4
140 0.42
141 0.39
142 0.37
143 0.37
144 0.3
145 0.25
146 0.25
147 0.22
148 0.16
149 0.13
150 0.12
151 0.08
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.08
164 0.08
165 0.1
166 0.11
167 0.1
168 0.16
169 0.22
170 0.24
171 0.25
172 0.28
173 0.3
174 0.38
175 0.45
176 0.42
177 0.43
178 0.44
179 0.43
180 0.44
181 0.42
182 0.42
183 0.44
184 0.47
185 0.46
186 0.52
187 0.56
188 0.56
189 0.55
190 0.48
191 0.46
192 0.47
193 0.47
194 0.44
195 0.4
196 0.46
197 0.48
198 0.46
199 0.4
200 0.34
201 0.31
202 0.26
203 0.29
204 0.27
205 0.3
206 0.3
207 0.38
208 0.4
209 0.38
210 0.41
211 0.38
212 0.32
213 0.32
214 0.33
215 0.31
216 0.37
217 0.41
218 0.38
219 0.43
220 0.48
221 0.51
222 0.58
223 0.59
224 0.63
225 0.68
226 0.77
227 0.78
228 0.83
229 0.85
230 0.79
231 0.79
232 0.77
233 0.77
234 0.78
235 0.72