Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V2LAI0

Protein Details
Accession A0A1V2LAI0    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-54YGSLAKKAEKKDKVRKSRSSAESFHydrophilic
151-174KEEPKKDAKKESGAKKGKKKKGKRBasic
NLS Segment(s)
PositionSequence
36-47KKAEKKDKVRKS
154-174PKKDAKKESGAKKGKKKKGKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPSITSTDSFIERSLQLLETAPSTTRVSITYGSLAKKAEKKDKVRKSRSSAESFVSFKVYDPLSGSLYKLTTRRAKELSRVLSALGPHGVQVVKKLPKRVKEINVTVSDDDGDVSVNDVQPVEETVTLQTRGFSSVLANSEIEEEVWQEVKEEPKKDAKKESGAKKGKKKKGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.14
5 0.15
6 0.13
7 0.14
8 0.13
9 0.14
10 0.15
11 0.15
12 0.14
13 0.15
14 0.16
15 0.16
16 0.17
17 0.18
18 0.2
19 0.21
20 0.22
21 0.23
22 0.26
23 0.3
24 0.36
25 0.41
26 0.47
27 0.56
28 0.64
29 0.74
30 0.79
31 0.83
32 0.85
33 0.83
34 0.84
35 0.82
36 0.77
37 0.69
38 0.62
39 0.56
40 0.49
41 0.42
42 0.34
43 0.26
44 0.2
45 0.2
46 0.17
47 0.13
48 0.14
49 0.15
50 0.14
51 0.15
52 0.15
53 0.13
54 0.13
55 0.15
56 0.14
57 0.18
58 0.23
59 0.25
60 0.29
61 0.33
62 0.34
63 0.38
64 0.44
65 0.42
66 0.37
67 0.35
68 0.3
69 0.27
70 0.25
71 0.2
72 0.13
73 0.09
74 0.07
75 0.08
76 0.08
77 0.06
78 0.08
79 0.13
80 0.19
81 0.21
82 0.29
83 0.32
84 0.38
85 0.46
86 0.51
87 0.52
88 0.54
89 0.56
90 0.54
91 0.53
92 0.49
93 0.42
94 0.35
95 0.28
96 0.2
97 0.16
98 0.1
99 0.07
100 0.04
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.06
111 0.07
112 0.08
113 0.11
114 0.12
115 0.12
116 0.11
117 0.11
118 0.13
119 0.12
120 0.11
121 0.1
122 0.12
123 0.14
124 0.15
125 0.14
126 0.12
127 0.14
128 0.13
129 0.12
130 0.1
131 0.09
132 0.09
133 0.1
134 0.09
135 0.09
136 0.12
137 0.2
138 0.26
139 0.27
140 0.3
141 0.39
142 0.46
143 0.51
144 0.58
145 0.57
146 0.61
147 0.68
148 0.74
149 0.74
150 0.78
151 0.81
152 0.83
153 0.87
154 0.87