Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061ARF8

Protein Details
Accession A0A061ARF8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-84GEKRARKVAKKRLGTFKRAKBasic
NLS Segment(s)
PositionSequence
64-86AGEKRARKVAKKRLGTFKRAKAK
Subcellular Location(s) mito 15, cyto 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAAKSGIAVGLNKGRKVESLEKIPKISYRKGAASKRTTFVRSIVREVAGLAPYERRLMELIRNAGEKRARKVAKKRLGTFKRAKAKVEEVNNIIAQSRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.31
4 0.36
5 0.34
6 0.41
7 0.48
8 0.5
9 0.51
10 0.5
11 0.49
12 0.46
13 0.44
14 0.4
15 0.37
16 0.4
17 0.47
18 0.53
19 0.56
20 0.59
21 0.57
22 0.55
23 0.54
24 0.5
25 0.42
26 0.4
27 0.39
28 0.33
29 0.33
30 0.31
31 0.27
32 0.25
33 0.24
34 0.21
35 0.13
36 0.11
37 0.08
38 0.08
39 0.08
40 0.09
41 0.08
42 0.07
43 0.08
44 0.09
45 0.13
46 0.16
47 0.18
48 0.19
49 0.21
50 0.2
51 0.24
52 0.29
53 0.28
54 0.28
55 0.36
56 0.39
57 0.45
58 0.56
59 0.62
60 0.66
61 0.72
62 0.76
63 0.77
64 0.79
65 0.8
66 0.8
67 0.79
68 0.79
69 0.74
70 0.69
71 0.64
72 0.66
73 0.64
74 0.62
75 0.59
76 0.5
77 0.51
78 0.49
79 0.42
80 0.36