Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XLD6

Protein Details
Accession B7XLD6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
141-161NGQRTRSNGRNKKAFGNKKKKBasic
NLS Segment(s)
PositionSequence
146-161RSNGRNKKAFGNKKKK
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 10.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027437  30s_Rbsml_prot_S13_C  
IPR001892  Ribosomal_S13  
IPR010979  Ribosomal_S13-like_H2TH  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00416  Ribosomal_S13  
PROSITE View protein in PROSITE  
PS50159  RIBOSOMAL_S13_2  
Amino Acid Sequences MVKVESRTDVRRFDADTMQHIIRLYNTNIDGTKKIVFALTRIRGLGMRFAKAAVLRAGVDPSKFAGELSPEEIASIQNVIDEPLKYSIPEYFLNHQKDSVTGEDEHLVGIKLDGDLRMLIEKAKKFKEIRGCRLAMGLKCNGQRTRSNGRNKKAFGNKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.36
4 0.37
5 0.33
6 0.32
7 0.29
8 0.26
9 0.22
10 0.24
11 0.21
12 0.21
13 0.21
14 0.22
15 0.23
16 0.25
17 0.24
18 0.22
19 0.22
20 0.18
21 0.17
22 0.17
23 0.16
24 0.16
25 0.24
26 0.25
27 0.24
28 0.24
29 0.24
30 0.24
31 0.24
32 0.3
33 0.22
34 0.2
35 0.19
36 0.19
37 0.2
38 0.18
39 0.2
40 0.12
41 0.11
42 0.11
43 0.11
44 0.13
45 0.12
46 0.11
47 0.1
48 0.1
49 0.1
50 0.09
51 0.08
52 0.07
53 0.08
54 0.09
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.09
61 0.07
62 0.06
63 0.04
64 0.04
65 0.04
66 0.05
67 0.06
68 0.06
69 0.07
70 0.08
71 0.08
72 0.08
73 0.09
74 0.09
75 0.11
76 0.13
77 0.15
78 0.18
79 0.26
80 0.29
81 0.29
82 0.29
83 0.26
84 0.25
85 0.24
86 0.21
87 0.16
88 0.13
89 0.13
90 0.14
91 0.13
92 0.12
93 0.1
94 0.09
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.06
104 0.07
105 0.07
106 0.09
107 0.15
108 0.18
109 0.24
110 0.27
111 0.34
112 0.34
113 0.41
114 0.5
115 0.54
116 0.59
117 0.61
118 0.59
119 0.53
120 0.56
121 0.55
122 0.46
123 0.42
124 0.37
125 0.34
126 0.37
127 0.43
128 0.42
129 0.41
130 0.44
131 0.47
132 0.54
133 0.57
134 0.64
135 0.67
136 0.73
137 0.78
138 0.75
139 0.78
140 0.78
141 0.8