Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061AVA3

Protein Details
Accession A0A061AVA3    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
270-300DDASKKRKRQAAAKAEKAKKRRARVEVEYEEBasic
NLS Segment(s)
PositionSequence
140-156KVKRREENRERKALAAA
274-293KKRKRQAAAKAEKAKKRRAR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSDEIIWQVINQQFCSFKLKTTKEQTFCRNEFNVSGLCSRQSCPLANAKYATVKNIDGKLYLYMKTAERAHTPAKLWERIKLSKNYTKALEQIDNHLLYWNKFLIHKCKQRLTRLTQVAITERRMALRDEERHYVGVAPKVKRREENRERKALAAAKIEKAIEKELLERLKSGAYGDKPLNVDEKIWKKVLGTVEDEDGIEMEEEEDYSDMEEEEEEDDSDVGEIEYVEDDGDDELVDVEDLERWLDGSDSEMSQQDTDSSDSDSDSDDDDASKKRKRQAAAKAEKAKKRRARVEVEYEEEPAQTNTMIHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.32
3 0.26
4 0.29
5 0.37
6 0.42
7 0.49
8 0.57
9 0.65
10 0.65
11 0.73
12 0.75
13 0.75
14 0.72
15 0.69
16 0.62
17 0.55
18 0.48
19 0.44
20 0.37
21 0.29
22 0.29
23 0.23
24 0.24
25 0.23
26 0.23
27 0.26
28 0.27
29 0.26
30 0.28
31 0.35
32 0.36
33 0.38
34 0.38
35 0.34
36 0.38
37 0.37
38 0.36
39 0.29
40 0.29
41 0.31
42 0.32
43 0.31
44 0.24
45 0.25
46 0.27
47 0.26
48 0.24
49 0.2
50 0.2
51 0.2
52 0.24
53 0.25
54 0.23
55 0.24
56 0.27
57 0.28
58 0.3
59 0.3
60 0.33
61 0.37
62 0.42
63 0.4
64 0.42
65 0.46
66 0.49
67 0.54
68 0.54
69 0.55
70 0.54
71 0.57
72 0.55
73 0.51
74 0.47
75 0.44
76 0.41
77 0.39
78 0.33
79 0.34
80 0.35
81 0.32
82 0.3
83 0.29
84 0.25
85 0.2
86 0.22
87 0.17
88 0.14
89 0.17
90 0.2
91 0.26
92 0.35
93 0.42
94 0.46
95 0.54
96 0.59
97 0.65
98 0.7
99 0.68
100 0.68
101 0.65
102 0.6
103 0.54
104 0.48
105 0.44
106 0.39
107 0.33
108 0.26
109 0.21
110 0.21
111 0.2
112 0.19
113 0.18
114 0.23
115 0.27
116 0.28
117 0.31
118 0.31
119 0.3
120 0.29
121 0.27
122 0.22
123 0.22
124 0.24
125 0.24
126 0.28
127 0.33
128 0.35
129 0.39
130 0.43
131 0.49
132 0.54
133 0.62
134 0.65
135 0.68
136 0.66
137 0.6
138 0.59
139 0.52
140 0.44
141 0.39
142 0.34
143 0.27
144 0.27
145 0.26
146 0.23
147 0.19
148 0.17
149 0.12
150 0.11
151 0.11
152 0.14
153 0.16
154 0.15
155 0.15
156 0.14
157 0.13
158 0.13
159 0.12
160 0.12
161 0.12
162 0.15
163 0.15
164 0.17
165 0.18
166 0.18
167 0.2
168 0.16
169 0.16
170 0.2
171 0.24
172 0.24
173 0.25
174 0.24
175 0.22
176 0.26
177 0.28
178 0.24
179 0.22
180 0.2
181 0.21
182 0.21
183 0.2
184 0.16
185 0.12
186 0.09
187 0.06
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.05
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.06
233 0.06
234 0.05
235 0.07
236 0.09
237 0.09
238 0.11
239 0.12
240 0.13
241 0.13
242 0.13
243 0.11
244 0.11
245 0.12
246 0.12
247 0.13
248 0.12
249 0.12
250 0.13
251 0.13
252 0.12
253 0.12
254 0.12
255 0.11
256 0.11
257 0.14
258 0.2
259 0.25
260 0.31
261 0.35
262 0.42
263 0.48
264 0.55
265 0.62
266 0.66
267 0.71
268 0.75
269 0.8
270 0.83
271 0.85
272 0.86
273 0.84
274 0.84
275 0.82
276 0.81
277 0.81
278 0.79
279 0.8
280 0.8
281 0.84
282 0.8
283 0.76
284 0.67
285 0.6
286 0.52
287 0.43
288 0.35
289 0.25
290 0.19
291 0.14
292 0.13