Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XJR0

Protein Details
Accession B7XJR0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-116LKATRCRKRACGHSNQLRMKKTHydrophilic
NLS Segment(s)
PositionSequence
114-120KKTVKKK
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
Amino Acid Sequences MQIIIKTPTKLIIRNFENSMTIAQLREEIRNNMGLCISHMFNSVDNIKNVFKNGQIVYATPELLGGGNMTEGNKLISLNSLKTKICRKCYAHNALKATRCRKRACGHSNQLRMKKTVKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.41
4 0.39
5 0.34
6 0.3
7 0.23
8 0.19
9 0.15
10 0.13
11 0.16
12 0.16
13 0.18
14 0.2
15 0.2
16 0.21
17 0.26
18 0.26
19 0.22
20 0.21
21 0.17
22 0.16
23 0.16
24 0.15
25 0.11
26 0.13
27 0.13
28 0.12
29 0.15
30 0.17
31 0.17
32 0.17
33 0.19
34 0.18
35 0.18
36 0.19
37 0.17
38 0.14
39 0.16
40 0.16
41 0.16
42 0.15
43 0.14
44 0.16
45 0.16
46 0.15
47 0.11
48 0.1
49 0.08
50 0.07
51 0.07
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.08
64 0.09
65 0.12
66 0.15
67 0.18
68 0.18
69 0.23
70 0.32
71 0.36
72 0.42
73 0.48
74 0.5
75 0.57
76 0.66
77 0.72
78 0.71
79 0.71
80 0.7
81 0.68
82 0.7
83 0.69
84 0.69
85 0.66
86 0.65
87 0.64
88 0.65
89 0.67
90 0.71
91 0.71
92 0.73
93 0.76
94 0.79
95 0.84
96 0.85
97 0.85
98 0.78
99 0.73
100 0.71