Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V2L4X0

Protein Details
Accession A0A1V2L4X0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68GEKKRLSPKAWKKIQKKLFTHydrophilic
NLS Segment(s)
PositionSequence
51-62KKRLSPKAWKKI
Subcellular Location(s) cyto 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
Amino Acid Sequences MLNLVHPCIRGDCKDICPTIVEEKPSIDALGDELIWEGIEDVSELDESGEKKRLSPKAWKKIQKKLFTDEIGNVTYEDEEGIKHKLVVKASGQPVGVKSAFNAVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.34
4 0.31
5 0.32
6 0.34
7 0.32
8 0.3
9 0.24
10 0.24
11 0.25
12 0.24
13 0.21
14 0.14
15 0.11
16 0.09
17 0.09
18 0.08
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.06
35 0.08
36 0.14
37 0.13
38 0.15
39 0.21
40 0.26
41 0.28
42 0.38
43 0.47
44 0.52
45 0.61
46 0.69
47 0.7
48 0.75
49 0.81
50 0.79
51 0.72
52 0.68
53 0.65
54 0.58
55 0.53
56 0.45
57 0.39
58 0.3
59 0.27
60 0.21
61 0.15
62 0.13
63 0.11
64 0.09
65 0.06
66 0.06
67 0.07
68 0.09
69 0.09
70 0.11
71 0.15
72 0.19
73 0.2
74 0.24
75 0.25
76 0.31
77 0.33
78 0.36
79 0.32
80 0.3
81 0.29
82 0.31
83 0.29
84 0.21
85 0.18
86 0.21