Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061AVV5

Protein Details
Accession A0A061AVV5   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
185-204DDSPRDRQLRGKKLVKPSYYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_nucl 15, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
IPR039949  NAA40  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043998  F:histone H2A acetyltransferase activity  
GO:0010485  F:histone H4 acetyltransferase activity  
Pfam View protein in Pfam  
PF13508  Acetyltransf_7  
PROSITE View protein in PROSITE  
PS51186  GNAT  
Amino Acid Sequences MSYQNFAFNSHEGLIEQHFPKTIALSKTNSSLIASRTIITQATPESIIPSLHLLKKTIGALYTKHKGQNWLSEKIEEMLEEGLTYVTYTTTDNRLVAFESFVLTEDEGVILLYLYEVHVDPEFHGLSIGTTLIESLHGLAETIRKGEQTFDGVDVSGIMGTKLTVFSDNTRALNWYKKLGYVLSDDSPRDRQLRGKKLVKPSYYLMERPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.22
4 0.19
5 0.2
6 0.2
7 0.2
8 0.21
9 0.25
10 0.24
11 0.27
12 0.3
13 0.31
14 0.34
15 0.34
16 0.31
17 0.27
18 0.24
19 0.22
20 0.23
21 0.22
22 0.18
23 0.18
24 0.19
25 0.17
26 0.15
27 0.15
28 0.11
29 0.12
30 0.12
31 0.11
32 0.12
33 0.12
34 0.12
35 0.11
36 0.14
37 0.16
38 0.19
39 0.2
40 0.2
41 0.19
42 0.22
43 0.23
44 0.2
45 0.17
46 0.16
47 0.17
48 0.23
49 0.27
50 0.27
51 0.3
52 0.3
53 0.35
54 0.36
55 0.43
56 0.42
57 0.43
58 0.41
59 0.38
60 0.37
61 0.32
62 0.29
63 0.19
64 0.15
65 0.09
66 0.07
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.04
73 0.03
74 0.04
75 0.05
76 0.06
77 0.09
78 0.1
79 0.1
80 0.1
81 0.11
82 0.11
83 0.1
84 0.09
85 0.07
86 0.07
87 0.06
88 0.07
89 0.07
90 0.06
91 0.05
92 0.05
93 0.05
94 0.04
95 0.04
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.03
103 0.03
104 0.04
105 0.05
106 0.05
107 0.06
108 0.08
109 0.08
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.06
116 0.04
117 0.03
118 0.04
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.05
127 0.07
128 0.07
129 0.09
130 0.08
131 0.09
132 0.09
133 0.11
134 0.12
135 0.12
136 0.13
137 0.13
138 0.13
139 0.12
140 0.12
141 0.1
142 0.09
143 0.06
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.05
150 0.06
151 0.07
152 0.09
153 0.11
154 0.18
155 0.21
156 0.21
157 0.21
158 0.23
159 0.24
160 0.31
161 0.3
162 0.3
163 0.28
164 0.29
165 0.31
166 0.29
167 0.29
168 0.26
169 0.27
170 0.26
171 0.28
172 0.28
173 0.3
174 0.32
175 0.34
176 0.32
177 0.3
178 0.35
179 0.42
180 0.51
181 0.57
182 0.62
183 0.66
184 0.74
185 0.81
186 0.76
187 0.7
188 0.65
189 0.64
190 0.61