Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XNK4

Protein Details
Accession B7XNK4    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-51NDKDKAKTFAGKKNNNKVKNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, cyto 12, nucl 9, mito 4
Family & Domain DBs
Amino Acid Sequences MFCFHELLLFFNIIYNSSVINTQLIVEEGTRNDKDKAKTFAGKKNNNKVKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.09
4 0.09
5 0.09
6 0.08
7 0.08
8 0.07
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.07
16 0.11
17 0.12
18 0.13
19 0.16
20 0.21
21 0.26
22 0.31
23 0.36
24 0.38
25 0.46
26 0.5
27 0.56
28 0.61
29 0.67
30 0.71
31 0.76